PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.17.616.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 98aa MW: 11410.9 Da PI: 10.476 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.8 | 4.3e-17 | 2 | 42 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 WT+eEd++l +++++G ++Wk a+++g ++t+kqc+ r+ gw1.17.616.1 2 WTPEEDDRLRALIERHGARRWKDLAQKLG-NKTAKQCRRRYT 42 *****************************.**********96 PP | |||||||
2 | Myb_DNA-binding | 50.3 | 5.4e-16 | 53 | 93 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 WT+eEde l++a+++lG++ W++Ia+t+g gRt++ k+r+ gw1.17.616.1 53 EWTAEEDEALLRAHEELGNK-WTAIAKTVG-GRTDNGAKNRFK 93 6*******************.*********.*****9999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.025 | 1 | 49 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.11E-28 | 1 | 92 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.5E-18 | 2 | 50 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-10 | 2 | 47 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 2 | 42 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.21E-12 | 2 | 45 | No hit | No description |
PROSITE profile | PS51294 | 15.911 | 50 | 98 | IPR017930 | Myb domain |
SMART | SM00717 | 2.3E-10 | 50 | 98 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-18 | 51 | 98 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-13 | 53 | 93 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.19E-8 | 53 | 96 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0010052 | Biological Process | guard cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MWTPEEDDRL RALIERHGAR RWKDLAQKLG NKTAKQCRRR YTGHLTTALK EHEWTAEEDE 60 ALLRAHEELG NKWTAIAKTV GGRTDNGAKN RFKALMQK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-26 | 2 | 98 | 30 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00259 | DAP | Transfer from AT2G02820 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001422172.1 | 9e-47 | predicted protein, partial | ||||
TrEMBL | A4SA32 | 2e-45 | A4SA32_OSTLU; Uncharacterized protein (Fragment) | ||||
STRING | ABP00489 | 3e-46 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 2e-26 | myb domain protein r1 |