PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ONIVA12G16170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 131aa MW: 14062.1 Da PI: 9.7328 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 93.9 | 1.2e-29 | 47 | 90 | 6 | 49 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49 +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrn ONIVA12G16170.1 47 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNT 90 68*****************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 1.1E-26 | 47 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 23.039 | 47 | 101 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 4.0E-18 | 49 | 90 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 49 | 85 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MEAPLHQSPV PLLPPPRVVG VQQQQQQEAV VPPPPAMAAA AGGGGREQCP RCASRDTKFC 60 YYNNYNTAQP RHFCRACRRY WTLGGSLRNT MSPTAALAIF SRKSGAGCRS STIAIFLHKS 120 GAEAQLGTTS C |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012620 | 1e-145 | CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002443463.1 | 1e-32 | dof zinc finger protein DOF1.6 | ||||
TrEMBL | A0A0E0JBV4 | 1e-91 | A0A0E0JBV4_ORYNI; Uncharacterized protein | ||||
STRING | ONIVA12G16170.1 | 2e-92 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP140 | 37 | 367 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G51700.1 | 3e-21 | DOF zinc finger protein 1 |