PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G04150.5
Organism
Oryza nivara
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 194aa    MW: 20645.9 Da    PI: 7.3704
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G04150.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.21.6e-28105157254
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYeg 54 
                      d g++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+ +d+++v++tY g
  ONIVA09G04150.5 105 DAGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERALHDTRAVITTYAG 157
                      569************************************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
Gene3DG3DSA:2.20.25.805.6E-2886157IPR003657WRKY domain
PROSITE profilePS5081130.11399164IPR003657WRKY domain
SuperFamilySSF1182901.57E-23100157IPR003657WRKY domain
SMARTSM007747.8E-30104163IPR003657WRKY domain
PfamPF031069.6E-21107157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006885Biological Processregulation of pH
GO:0035725Biological Processsodium ion transmembrane transport
GO:1902600Biological Processhydrogen ion transmembrane transport
GO:0005768Cellular Componentendosome
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0015385Molecular Functionsodium:proton antiporter activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MPLRAGSRPV LRNTSSGCAA AAACADQYSA ATPDNSSVTF GDDEADNESH SSEGYEPEAK  60
CWKEDADNEG SSGGMGGGAG GKPVRKPRLV VHTLSDIDIN IDILDAGFRW RKYGQKVVKG  120
NPNPRSYYKC TTVGCPVRKH VERALHDTRA VITTYAGAVV QRDPAVGSAN GAGAAFQRTK  180
DKPRDDLFVE SLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-261011651478Probable WRKY transcription factor 4
2lex_A3e-261011651478Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1904361e-146AB190436.1 Oryza sativa Japonica Group OsWRKY53 mRNA for transcription factor OsWRKY53, complete cds.
GenBankAK1211901e-146AK121190.1 Oryza sativa Japonica Group cDNA clone:J023086B03, full insert sequence.
GenBankAY6769291e-146AY676929.1 Oryza sativa (indica cultivar-group) transcription factor WRKY53 (WRKY53) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655211.18e-76PREDICTED: probable WRKY transcription factor 26
SwissprotQ6B6R43e-45WRK24_ORYSI; WRKY transcription factor WRKY24
SwissprotQ6IEQ73e-45WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLA0A0E0IHG11e-135A0A0E0IHG1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0IHG51e-141A0A0E0IHG5_ORYNI; Uncharacterized protein
STRINGONIVA09G04150.11e-135(Oryza nivara)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.17e-37WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  4. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]