PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN542159.1_FGP001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 78aa MW: 8885.85 Da PI: 6.2438 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.6 | 4.6e-11 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T+eE++l + +++ G++ W++Ia +++ gRt+k++ +w KN542159.1_FGP001 33 FTEEEEDLVFRMHRLVGNR-WELIAGRIP-GRTAKEVEMFW 71 8******************.*********.******98887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.9E-7 | 29 | 77 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-13 | 33 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.25E-9 | 33 | 71 | No hit | No description |
PROSITE profile | PS50090 | 7.073 | 33 | 71 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 2.11E-9 | 33 | 72 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.6E-10 | 33 | 71 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MDSSSGSQGK NSKTSDGCET KEVNSTAQNF IHFTEEEEDL VFRMHRLVGN RWELIAGRIP 60 GRTAKEVEMF WAVKHQNT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN542159.1_FGP001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT833447 | 1e-120 | CT833447.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA029N02, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006644378.1 | 5e-45 | PREDICTED: MYB-like transcription factor ETC3 | ||||
Swissprot | B3H4X8 | 7e-21 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
TrEMBL | A0A0D3ERB6 | 1e-50 | A0A0D3ERB6_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A2WSP8 | 1e-50 | A2WSP8_ORYSI; Uncharacterized protein | ||||
TrEMBL | A2ZVH2 | 1e-50 | A2ZVH2_ORYSJ; Uncharacterized protein | ||||
STRING | OBART01G22980.1 | 2e-51 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5275 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30424.1 | 3e-23 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|