PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN540035.1_FGP004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 146aa MW: 15806 Da PI: 8.5973 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 139 | 1.6e-43 | 38 | 136 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCk+lrrkC++dCv+apyfp ++p+kf vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+v++i+ lq++l+ql++ KN540035.1_FGP004 38 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAIISILQRNLRQLQQ 129 7******************************************************************************************* PP DUF260 93 elallke 99 +la++k KN540035.1_FGP004 130 DLARAKF 136 **99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.332 | 37 | 138 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.7E-43 | 38 | 134 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009799 | Biological Process | specification of symmetry | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0005654 | Cellular Component | nucleoplasm |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MASSSASSVP APSGSVITIA SASASAAANT AACGTGSPCA ACKFLRRKCQ PDCVFAPYFP 60 PDNPQKFVHV HRVFGASNVT KLLNELHPYQ REDAVNSLAY EADMRLRDPV YGCVAIISIL 120 QRNLRQLQQD LARAKFELSK YQQVTD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-55 | 34 | 141 | 7 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-55 | 34 | 141 | 7 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}. | |||||
UniProt | Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00211 | DAP | Transfer from AT1G65620 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN540035.1_FGP004 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP003431 | 0.0 | AP003431.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1099D03. | |||
GenBank | AP014957 | 0.0 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012609 | 0.0 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015634701.1 | 1e-102 | LOB domain-containing protein 6 | ||||
Swissprot | A2WXT0 | 1e-104 | LBD6_ORYSI; LOB domain-containing protein 6 | ||||
Swissprot | Q8LQH4 | 1e-104 | LBD6_ORYSJ; LOB domain-containing protein 6 | ||||
TrEMBL | A0A0D9YIG2 | 1e-101 | A0A0D9YIG2_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0FWT2 | 1e-101 | A0A0E0FWT2_ORYNI; Uncharacterized protein | ||||
STRING | OS01T0889400-02 | 1e-102 | (Oryza sativa) | ||||
STRING | ONIVA01G44840.2 | 1e-102 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2267 | 38 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 1e-55 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|