PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539463.1_FGP011 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 231aa MW: 24174.4 Da PI: 5.0914 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 23 | 1.7e-07 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 C+ +e ++ C ++ lC+ C +e+H H++ p KN539463.1_FGP011 4 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46 6******99*********************6678888898877 PP | |||||||
2 | zf-B_box | 26.9 | 9.8e-09 | 55 | 86 | 3 | 34 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeH 34 ++C+ ++ek + +fC +++ l+C+dC + +H KN539463.1_FGP011 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86 589**************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 10.096 | 1 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 2.5E-5 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 4.6E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 6.4E-14 | 53 | 100 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 8.517 | 53 | 100 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 2.2E-6 | 56 | 96 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.36E-7 | 56 | 86 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0010100 | Biological Process | negative regulation of photomorphogenesis | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090351 | Biological Process | seedling development | ||||
GO:1902448 | Biological Process | positive regulation of shade avoidance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003712 | Molecular Function | transcription cofactor activity | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 231 aa Download sequence Send to blast |
MRIQCDACEA AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAA LPAALPRCDV 60 CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGNHQRYLA TGIRVGFSSV CSANADHLPP 120 PAPKGNSKPP ASGVAAAAAG APKPAVSAAA QEKGSPIGFK DLEWLDDIDL FHVQSPAKGG 180 STAAEVPELF ASPQPASNMG IYKASGARQS KKPRVEIPDD DEDFFIVPDL G |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). BBX25/STH and BBX24/STO function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX25/STH acts additively with BBX24/STO during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). {ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:23624715}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539463.1_FGP011 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT841767 | 0.0 | CT841767.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C103C07, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015636444.1 | 1e-139 | B-box zinc finger protein 24 | ||||
Swissprot | Q96288 | 2e-64 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
Swissprot | Q9SID1 | 2e-64 | BBX25_ARATH; B-box zinc finger protein 25 | ||||
TrEMBL | A0A0E0KS89 | 1e-150 | A0A0E0KS89_ORYPU; Uncharacterized protein | ||||
STRING | OPUNC04G14930.1 | 1e-151 | (Oryza punctata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3202 | 33 | 68 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.1 | 2e-41 | DBB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|