PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539176.1_FGP007 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 251aa MW: 28095.7 Da PI: 5.6468 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.8 | 2.5e-27 | 31 | 81 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl ++s KN539176.1_FGP007 31 KRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSHFAS 81 79*********************************************9986 PP | |||||||
2 | K-box | 56.4 | 1.3e-19 | 112 | 193 | 18 | 99 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + ++a L++++ + +R++ Ge+Le Ls+ eLqqLe++Le +l ++ +K++ ++eqi+elq+k +l een++Lr+++ KN539176.1_FGP007 112 HSKYAHLNEQLAEASLRLRQMRGEELEGLSIDELQQLEKNLEAGLHRVMLTKDQQFMEQISELQRKSSQLAEENMQLRNQVS 193 334555555555555889************************************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00404 | 6.7E-23 | 25 | 45 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.5E-31 | 26 | 82 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.71E-29 | 29 | 96 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.01E-39 | 29 | 97 | No hit | No description |
PROSITE profile | PS50066 | 26.156 | 29 | 83 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-25 | 32 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.7E-23 | 45 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.7E-23 | 60 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 14.082 | 108 | 198 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.7E-17 | 114 | 192 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 251 aa Download sequence Send to blast |
MPLPTIAPQP PHRLAASPFI LRFFFGLREI KRIESAAARQ VTFSKRRRGL FKKAEELSVL 60 CDADVALIVF SSTGKLSHFA SSSMNEIIDK YNTHSNNLGK AEQPSLDLNL EHSKYAHLNE 120 QLAEASLRLR QMRGEELEGL SIDELQQLEK NLEAGLHRVM LTKDQQFMEQ ISELQRKSSQ 180 LAEENMQLRN QVSQISPAEK QVVDTENFVT EEGQSSESVM TALHSGSSQS QDNDDGSDVS 240 LKLGLPCGAW K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-17 | 29 | 95 | 7 | 73 | MEF2C |
5f28_B | 2e-17 | 29 | 95 | 7 | 73 | MEF2C |
5f28_C | 2e-17 | 29 | 95 | 7 | 73 | MEF2C |
5f28_D | 2e-17 | 29 | 95 | 7 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be required for spikelet (rice flower) development. {ECO:0000269|PubMed:15682279}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539176.1_FGP007 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT834517 | 0.0 | CT834517.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA022M02, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015624915.1 | 1e-160 | MADS-box transcription factor 22 | ||||
Swissprot | Q9XJ66 | 1e-161 | MAD22_ORYSJ; MADS-box transcription factor 22 | ||||
TrEMBL | A0A0E0CRT6 | 1e-161 | A0A0E0CRT6_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0GD99 | 1e-161 | A0A0E0GD99_ORYNI; Uncharacterized protein | ||||
TrEMBL | A2X9V3 | 1e-161 | A2X9V3_ORYSI; Uncharacterized protein | ||||
STRING | OMERI02G31030.1 | 1e-162 | (Oryza meridionalis) | ||||
STRING | ONIVA02G35910.1 | 1e-162 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1221 | 36 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 7e-73 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|