PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539014.1_FGP004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 197aa MW: 21909.8 Da PI: 7.5947 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 81.7 | 1.6e-25 | 9 | 76 | 1 | 69 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 lppGfrFhPtdeel+v+yL+++++++++++ ++i++vdiyk++PwdLp+k++ +++ewyfFs+rd+++ KN539014.1_FGP004 9 LPPGFRFHPTDEELIVHYLRNRAASSPCPV-SIIADVDIYKFDPWDLPSKANYGDREWYFFSPRDRNSG 76 79****************************.89***************999999***********9875 PP | |||||||
2 | NAM | 42.6 | 1.9e-13 | 85 | 116 | 97 | 128 |
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 +e vg+kk Lvfykgr pkg+kt+W+mheyrl KN539014.1_FGP004 85 NESVGVKKALVFYKGRPPKGTKTNWIMHEYRL 116 678***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.62E-50 | 5 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 35.08 | 9 | 150 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.9E-22 | 10 | 116 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MVLSNPAMLP PGFRFHPTDE ELIVHYLRNR AASSPCPVSI IADVDIYKFD PWDLPSKANY 60 GDREWYFFSP RDRNSGGGGG GAATNESVGV KKALVFYKGR PPKGTKTNWI MHEYRLAAAD 120 AHAANTYRPM KFRNTSMRLD DWVLCRIYRK SSHASPLAVP PLSDHEQDEP CALEENAPLQ 180 RLAGIITGTE PPDAAPL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-52 | 9 | 155 | 20 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539014.1_FGP004 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK243514 | 1e-163 | AK243514.1 Oryza sativa Japonica Group cDNA, clone: J100075D15, full insert sequence. | |||
GenBank | JN982313 | 1e-163 | JN982313.1 Oryza sativa Japonica Group NAC transcription factor 58 (NAC58) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015632401.1 | 1e-114 | NAC transcription factor 47 | ||||
Swissprot | Q84TD6 | 7e-63 | NAC47_ARATH; NAC transcription factor 47 | ||||
TrEMBL | A0A0E0GLU4 | 1e-113 | A0A0E0GLU4_ORYNI; Uncharacterized protein | ||||
STRING | ONIVA03G16920.1 | 1e-114 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1237 | 36 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.1 | 4e-64 | NAC domain containing protein 47 |
Publications ? help Back to Top | |||
---|---|---|---|
|