PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN538899.1_FGP013

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NAC

Protein Properties

Length: 59aa MW: 6791.67 Da PI: 4.3999

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN538899.1_FGP013	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	57.3	5.3e-18	11	57	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd++ KN538899.1_FGP013 11 VPPGFRFHPTEEELLNYYLRKKVASEQIDL-DVIRDVDLNKLEPWDIQ 57 69**************************.9************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.05E-18	7	58	IPR003441	NAC domain
PROSITE profile	PS51005	20.317	11	59	IPR003441	NAC domain
Pfam	PF02365	1.2E-8	12	54	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEQIDL DVIRDVDLNK LEPWDIQGS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN538899.1_FGP013

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP004562	6e-93	AP004562.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0470F10.
GenBank	AP005657	6e-93	AP005657.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0427G12.
GenBank	AP014964	6e-93	AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015648974.1	1e-35	NAC domain-containing protein 43
Refseq	XP_015695478.1	4e-36	PREDICTED: NAC domain-containing protein 43-like
Swissprot	Q84WP6	2e-29	NAC43_ARATH; NAC domain-containing protein 43
TrEMBL	A0A0E0I6L0	8e-35	A0A0E0I6L0_ORYNI; Uncharacterized protein
TrEMBL	B8BA72	1e-36	B8BA72_ORYSI; Uncharacterized protein
TrEMBL	B8BA74	1e-35	B8BA74_ORYSI; Uncharacterized protein
TrEMBL	Q6YXS5	1e-35	Q6YXS5_ORYSJ; Os08g0115800 protein
STRING	OGLUM08G01180.1	4e-35	(Oryza glumipatula)
STRING	OS08T0115800-01	2e-36	(Oryza sativa)
STRING	ONIVA08G01130.1	1e-35	(Oryza nivara)
STRING	OPUNC08G01110.1	3e-35	(Oryza punctata)
STRING	ORGLA08G0004900.1	4e-35	(Oryza glaberrima)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP16506	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46770.1	9e-32	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gondolf VM, et al. A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis. BMC Plant Biol., 2014. 14: p. 344 [PMID:25492673] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073] Liu C,Yu H,Li L SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana. PLoS Genet., 2019. 15(1): p. e1007928 [PMID:30657769]