PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN538687.1_FGP200

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

bZIP

Protein Properties

Length: 224aa MW: 24522.6 Da PI: 5.9801

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN538687.1_FGP200	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	34.4	4.8e-11	69	117	3	51
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 +l + rr NReA r++R++Kka + Lee+vk+L a N++L k+l+ KN538687.1_FGP200 69 DLTKPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLKRLQG 117 6778899999**********************************99975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.3E-11	67	134	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	5.6E-16	67	135	No hit	No description
PROSITE profile	PS50217	8.91	69	116	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	1.8E-13	71	124	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	4.5E-8	72	117	No hit	No description
CDD	cd14686	7.50E-13	74	125	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MDDVPSQLLF SHPEVPDSFD DFLNNITTCT HTHTCNPPGP SATTHTHTCL HTHTQVFASG 60 SGEDDIKEDL TKPRRPLGNR EAVRKYREKK KAHAAFLEEE VKKLRAANQQ LLKRLQGHAA 120 LEAEVIRLRS ILLDVRGKID MEIGTFPYQK PCSVGSVACT DPGMCFNGNS EIGGVWEECS 180 RPAGADRMID KDGSMSQEID IPGPVHSISM DVVGSLVTSA SLSE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN538687.1_FGP200

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC112160	0.0	AC112160.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1579_G03, complete sequence.
GenBank	AK072281	0.0	AK072281.1 Oryza sativa Japonica Group cDNA clone:J023018E07, full insert sequence.
GenBank	AK104986	0.0	AK104986.1 Oryza sativa Japonica Group cDNA clone:002-110-E11, full insert sequence.
GenBank	AP014961	0.0	AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015638714.1	1e-165	basic leucine zipper 23
Refseq	XP_025881179.1	1e-165	basic leucine zipper 23
Refseq	XP_025881180.1	1e-165	basic leucine zipper 23
Refseq	XP_025881181.1	1e-165	basic leucine zipper 23
Refseq	XP_025881182.1	1e-165	basic leucine zipper 23
Swissprot	Q8GTS2	3e-56	BZP23_ARATH; Basic leucine zipper 23
TrEMBL	A0A0D3G9C5	1e-164	A0A0D3G9C5_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0PPE3	1e-164	A0A0E0PPE3_ORYRU; Uncharacterized protein
TrEMBL	I1PWW4	1e-164	I1PWW4_ORYGL; Uncharacterized protein
TrEMBL	Q65X73	1e-164	Q65X73_ORYSJ; Os05g0495200 protein
STRING	OMERI05G18470.1	1e-166	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3831	36	75

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16770.1	6e-40	bZIP family protein

Publications ? help Back to Top
Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]