PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OGLUM09G04670.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 167aa MW: 17763.7 Da PI: 7.4067 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 90.6 | 1.2e-28 | 105 | 157 | 2 | 54 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYeg 54 d g++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+ +d+++v++tY g OGLUM09G04670.5 105 DAGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERALHDTRAVITTYAG 157 569************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51257 | 5 | 1 | 24 | No hit | No description |
Gene3D | G3DSA:2.20.25.80 | 4.0E-28 | 86 | 157 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.113 | 99 | 164 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.14E-23 | 100 | 157 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.8E-30 | 104 | 163 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.2E-21 | 107 | 157 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006885 | Biological Process | regulation of pH | ||||
GO:0035725 | Biological Process | sodium ion transmembrane transport | ||||
GO:1902600 | Biological Process | hydrogen ion transmembrane transport | ||||
GO:0005768 | Cellular Component | endosome | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0015385 | Molecular Function | sodium:proton antiporter activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MPLRAGSRPV LRNTPSGCAA AAACADQYSA ATPDNSSVTF GDDEADNESH SSEGYEPEAK 60 CWKEDADNEG SSGGMGGGAG GKPVRKPRLV VHTLSDIDIN IDILDAGFRW RKYGQKVVKG 120 NPNPRSYYKC TTVGCPVRKH VERALHDTRA VITTYAGAVV QRDPAVG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-26 | 101 | 165 | 14 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 2e-26 | 101 | 165 | 14 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}. | |||||
UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}. | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB190436 | 1e-147 | AB190436.1 Oryza sativa Japonica Group OsWRKY53 mRNA for transcription factor OsWRKY53, complete cds. | |||
GenBank | AK121190 | 1e-147 | AK121190.1 Oryza sativa Japonica Group cDNA clone:J023086B03, full insert sequence. | |||
GenBank | AY676929 | 1e-147 | AY676929.1 Oryza sativa (indica cultivar-group) transcription factor WRKY53 (WRKY53) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015640378.1 | 2e-66 | probable WRKY transcription factor 26 isoform X2 | ||||
Swissprot | Q6B6R4 | 2e-45 | WRK24_ORYSI; WRKY transcription factor WRKY24 | ||||
Swissprot | Q6IEQ7 | 2e-45 | WRK24_ORYSJ; WRKY transcription factor WRKY24 | ||||
TrEMBL | A0A0E0B0V3 | 1e-120 | A0A0E0B0V3_9ORYZ; Uncharacterized protein | ||||
STRING | OGLUM09G04670.1 | 1e-116 | (Oryza glumipatula) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38470.1 | 3e-36 | WRKY DNA-binding protein 33 |
Publications ? help Back to Top | |||
---|---|---|---|
|