PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OGLUM08G22820.2

Organism

Oryza glumaepatula

Taxonomic ID

40148

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MIKC_MADS

Protein Properties

Length: 273aa MW: 31465.2 Da PI: 9.1762

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OGLUM08G22820.2	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.6	1.2e-31	33	83	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s OGLUM08G22820.2 33 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 83 79***********************************************96 PP
2	K-box	74	4.3e-25	128	200	28	100
K-box 28 ienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +e+L R+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++ +e+n++Lr+klee OGLUM08G22820.2 128 TEKLCVYERNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMFSEANRCLRRKLEE 200 57778788**************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-41	25	84	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.389	25	85	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.90E-45	26	101	No hit	No description
SuperFamily	SSF55455	1.1E-33	26	110	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	27	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	27	47	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-26	34	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	47	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	62	83	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.912	114	204	IPR002487	Transcription factor, K-box
Pfam	PF01486	5.5E-19	128	198	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001708	Biological Process	cell fate specification
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010093	Biological Process	specification of floral organ identity
GO:0048481	Biological Process	plant ovule development
GO:0048833	Biological Process	specification of floral organ number
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 273 aa Download sequence Send to blast
MAEKKKKKKK PQSLLVLTSW RSIGMGRGRV ELKRIENKIN RQVTFAKRRN GLLKKAYELS 60 VLCDAEVALI IFSNRGKLYE FCSTQSMTKT LEKYQKCSYA GPETAVQNRE SEFGLKFGIW 120 LKLETDVTEK LCVYERNLLG EDLDSLGIKE LESLEKQLDS SLKHVRTTRT KHLVDQLTEL 180 QRKEQMFSEA NRCLRRKLEE SNHVRGQQVW EQGCNLIGYE RQPEVQQPLH GGNGFFHPLD 240 AAGEPTLQIG YPAEQHEAMN SACMNTYMPP WLP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-20	25	108	1	81	MEF2 CHIMERA
6byy_B	1e-20	25	108	1	81	MEF2 CHIMERA
6byy_C	1e-20	25	108	1	81	MEF2 CHIMERA
6byy_D	1e-20	25	108	1	81	MEF2 CHIMERA
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	2	10	EKKKKKKKP
2	3	9	KKKKKKK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00605	ChIP-seq	Transfer from AT1G24260	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY551921	0.0	AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015648762.1	1e-166	MADS-box transcription factor 7
Swissprot	P0C5B0	1e-167	MADS7_ORYSI; MADS-box transcription factor 7
Swissprot	Q0J466	1e-167	MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBL	A0A0E0AY27	0.0	A0A0E0AY27_9ORYZ; Uncharacterized protein
STRING	OGLUM08G22820.1	0.0	(Oryza glumipatula)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.1	2e-81	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Shitsukawa N, et al. Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat. Plant Cell, 2007. 19(6): p. 1723-37 [PMID:17586655] Bai X,Wang Q,Chu C Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter. Transgenic Res., 2008. 17(6): p. 1035-43 [PMID:18437520] Qu L, et al. Expression pattern and functional analysis of a MADS-box gene M79 from rice. Sci. China, C, Life Sci., 2001. 44(2): p. 161-9 [PMID:18726433] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Tang X, et al. Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis. Plant Physiol., 2010. 154(4): p. 1855-70 [PMID:20959420] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yoshida H Is the lodicule a petal: molecular evidence? Plant Sci., 2012. 184: p. 121-8 [PMID:22284716] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Wong CE,Singh MB,Bhalla PL Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean. BMC Plant Biol., 2013. 13: p. 105 [PMID:23870482] Hu Z,Ding X,Hu S,Sun Y,Xia L Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice. Biotechnol. Lett., 2013. 35(12): p. 2177-83 [PMID:23974493] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504]