PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OGLUM05G05440.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 190aa MW: 21012.2 Da PI: 6.2711 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.3 | 4.4e-30 | 100 | 158 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver++ed ++v++tY g Hnh OGLUM05G05440.1 100 LDDGFKWRKYGKKAVKNSPNPRNYYRCSTEGCSVKKRVERDREDHRYVITTYDGVHNHA 158 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.2E-32 | 88 | 160 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.96E-27 | 92 | 160 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.295 | 95 | 160 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.6E-34 | 100 | 159 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-23 | 101 | 157 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MAASVGLNPE AFFFSNSYSY SSSPFMASYT PELSAAAIDA DLFSGELDFD CSLPAPAFAG 60 ARQEYPENEN TMMRYESEEK MRARVNGRIG FRTRSEVEIL DDGFKWRKYG KKAVKNSPNP 120 RNYYRCSTEG CSVKKRVERD REDHRYVITT YDGVHNHASP AAAAGDYYSP PLSSAGSPPA 180 AYSAGGSLLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-26 | 86 | 161 | 3 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-26 | 86 | 161 | 3 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK066252 | 0.0 | AK066252.1 Oryza sativa Japonica Group cDNA clone:J013052M10, full insert sequence. | |||
GenBank | CT832802 | 0.0 | CT832802.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN033C24, full insert sequence. | |||
GenBank | HQ858875 | 0.0 | HQ858875.1 Oryza sativa Japonica Group isolate UT1752 WRKY transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015638018.1 | 1e-109 | probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0D9ZV04 | 1e-137 | A0A0D9ZV04_9ORYZ; Uncharacterized protein | ||||
STRING | OGLUM05G05440.1 | 1e-138 | (Oryza glumipatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-40 | WRKY DNA-binding protein 50 |