PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OGLUM03G06890.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 74aa MW: 7916.98 Da PI: 8.103 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 34.8 | 5.7e-11 | 34 | 74 | 5 | 45 |
TCP 5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkds 45 k ++++ h+kv+ + R+R+ + a +F+L +eLG+++d+ OGLUM03G06890.1 34 KPPSKDCHSKVDTLGCRIRMHIIYTAHIFQLNRELGHKSDG 74 8899***********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 9.302 | 37 | 74 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 7.9E-8 | 37 | 74 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MTKVHGDGGG GAALDKQLVP DASNDNGTAF AICKPPSKDC HSKVDTLGCR IRMHIIYTAH 60 IFQLNRELGH KSDG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of the circadian clock. Acts as a repressor of CCA1 by binding to its promoter. No binding to the LHY promoter. {ECO:0000269|PubMed:19286557}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC210480 | 3e-95 | AC210480.2 Oryza glaberrima clone OG_BBa0067M08, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015629543.1 | 1e-22 | transcription factor TCP21 | ||||
Swissprot | Q9FTA2 | 2e-14 | TCP21_ARATH; Transcription factor TCP21 | ||||
TrEMBL | A0A0D9Z3C0 | 5e-48 | A0A0D9Z3C0_9ORYZ; Uncharacterized protein | ||||
STRING | OGLUM03G06890.1 | 8e-49 | (Oryza glumipatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP38180 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08330.1 | 7e-17 | TCP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|