PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORGLA03G0061100.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 250aa MW: 27969.6 Da PI: 8.199 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.6 | 2.1e-25 | 29 | 78 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n rqvtfskRr g++KKAeELS+LCdaev +++fs tgkl+ ++s ORGLA03G0061100.1 29 RIDNLAARQVTFSKRRRGLFKKAEELSILCDAEVGLVVFSATGKLFQFAS 78 89*********************************************986 PP | |||||||
2 | K-box | 39.7 | 2e-14 | 110 | 191 | 18 | 99 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + a+Lk+e+ + +R++ Ge+L++L++++Lq+Le+ Le +l ++ ++K++ +l++i+ l +k +l een +L+++l+ ORGLA03G0061100.1 110 SSTCARLKEELAETSLRLRQMRGEELHRLNVEQLQELEKSLEFGLGSVLKTKSKKILDEIDGLERKRMQLIEENLRLKEQLQ 191 66789**********99*************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-33 | 20 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.319 | 20 | 80 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.14E-29 | 22 | 94 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.11E-37 | 22 | 93 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 22 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-25 | 22 | 42 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-24 | 29 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-25 | 42 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-25 | 57 | 78 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.634 | 106 | 198 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.6E-12 | 111 | 190 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MAGGGGGGGR GEGEGRAATG KRERIAIRRI DNLAARQVTF SKRRRGLFKK AEELSILCDA 60 EVGLVVFSAT GKLFQFASTS MKQIIDRYNS HSKTLQRAEP SQLDLQGEDS STCARLKEEL 120 AETSLRLRQM RGEELHRLNV EQLQELEKSL EFGLGSVLKT KSKKILDEID GLERKRMQLI 180 EENLRLKEQL QVSRMSRMEE MQPGPDSEIV YEEGQSSESV TNASYPRPPP DNDYSSDTSL 240 RLGLSLFSSK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 8e-20 | 22 | 92 | 3 | 73 | MEF2C |
5f28_B | 8e-20 | 22 | 92 | 3 | 73 | MEF2C |
5f28_C | 8e-20 | 22 | 92 | 3 | 73 | MEF2C |
5f28_D | 8e-20 | 22 | 92 | 3 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | ORGLA03G0061100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY345222 | 0.0 | AY345222.1 Oryza sativa (japonica cultivar-group) transcription factor MADS47-2 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015630610.1 | 1e-178 | MADS-box transcription factor 47 isoform X1 | ||||
Swissprot | Q5K4R0 | 1e-175 | MAD47_ORYSJ; MADS-box transcription factor 47 | ||||
TrEMBL | I1P8B5 | 1e-179 | I1P8B5_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA03G0061100.1 | 1e-180 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1221 | 36 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-78 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|