PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G23330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 433aa    MW: 49385.2 Da    PI: 11.503
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G23330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-14655148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd +l  +v+q+G++ W+++ ++m+  + R +k+c +rw +yl
     OB12G23330.1  6 RQRWRPEEDAILRAYVRQYGPREWNLVGQRMNaaLDRDAKSCLERWKNYL 55
                     89**********************************************97 PP

2Myb_DNA-binding33.69e-1161105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T +E+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
     OB12G23330.1  61 KGSLTDDEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 105
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.602155IPR017930Myb domain
SMARTSM007176.3E-12557IPR001005SANT/Myb domain
SuperFamilySSF466894.03E-206100IPR009057Homeodomain-like
CDDcd001672.11E-8855No hitNo description
Gene3DG3DSA:1.10.10.601.4E-19862IPR009057Homeodomain-like
PfamPF139211.2E-12969No hitNo description
PROSITE profilePS5129422.39156110IPR017930Myb domain
SMARTSM007171.4E-960108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-1463104IPR009057Homeodomain-like
CDDcd001676.54E-765106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MQMRERQRWR PEEDAILRAY VRQYGPREWN LVGQRMNAAL DRDAKSCLER WKNYLRPGIK  60
KGSLTDDEQR LVIRLQAKHG NKWKKIAAEV PGRTAKRLGK WWEVFKEKQQ RELRDSRRPP  120
PEPSPDERGR YDWLLENFAE KLVKERPVAV APLLMAAPML PPWMASLFVX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXAARG GARVPAAGGG GGVRGEDAGA AGGAGRRRGA RGGGVPRQDG  300
RPPPRRRAQG AEDGRAVGRQ ARPPRQVPRP GRHLPPLASR RDERRRRPVM PPPPPRFLDV  360
TNFVKPLHAA DAMSFCMLSC SLDFAFFASS LVLFETVGIF EFTSLEKKCN LESLLIIPSS  420
LALFNNKWTK IAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-15910210100B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB12G23330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3728391e-154AK372839.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3014B11.
GenBankAK3728891e-154AK372889.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3015B19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3NEC51e-100J3NEC5_ORYBR; Uncharacterized protein
STRINGOB12G23330.11e-100(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.15e-67MYB family protein