PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB05G13650.1 | ||||||||
Common Name | LOC102718272 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 141aa MW: 15433.3 Da PI: 9.1026 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.5 | 4.4e-19 | 23 | 57 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C++t+Tp+WR gp g+++LCnaCG++yrkk++ OB05G13650.1 23 CVECRATTTPMWRGGPTGPRSLCNACGIRYRKKRR 57 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.466 | 17 | 53 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.8E-14 | 17 | 67 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.71E-13 | 18 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.0E-14 | 21 | 58 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 6.03E-12 | 23 | 58 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 23 | 48 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 7.6E-17 | 23 | 57 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MGSSEQKVIG IAAAAEEEGR RCCVECRATT TPMWRGGPTG PRSLCNACGI RYRKKRRQEL 60 GLDNKQQQQP QPQPQQQQEH HHHQEDHSDA ASSVKDSSSS SSNKSSSLQV VKKRRVLMGV 120 EEAAILLMAL SSSSTPTLLH G |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB05G13650.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012613 | 1e-83 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006655008.1 | 1e-100 | PREDICTED: GATA transcription factor 23-like | ||||
Refseq | XP_015692844.1 | 1e-100 | PREDICTED: GATA transcription factor 23-like | ||||
TrEMBL | J3M441 | 8e-99 | J3M441_ORYBR; Uncharacterized protein | ||||
STRING | OB05G13650.1 | 1e-99 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 2e-15 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 102718272 |