PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB05G12090.1 | ||||||||
Common Name | LOC102704800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 150aa MW: 16120.1 Da PI: 10.7471 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.5 | 1.4e-13 | 24 | 79 | 4 | 59 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 ++ +r+ +NRe+ArrsR+RK++++eeL +++ L+aeN + ++ + e k+ OB05G12090.1 24 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYARELGKV 79 5678999*********************************9999998888776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.7E-18 | 21 | 85 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 9.0E-12 | 22 | 78 | No hit | No description |
PROSITE profile | PS50217 | 11.415 | 23 | 86 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.75E-10 | 25 | 77 | No hit | No description |
Pfam | PF00170 | 2.4E-9 | 25 | 75 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 28 | 43 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006971 | Biological Process | hypotonic response | ||||
GO:0009267 | Biological Process | cellular response to starvation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000693 | Biological Process | positive regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MSSPSRRSSS PESNTSGGGS GADERKRKRM LSNRESARRS RARKQQRLEE LIAEAARLQA 60 ENARVEAQIG AYARELGKVD GDNAVLRARH GELAGRLQAL GGVLEIFQVA GASVDIPEIP 120 DPLLRPWQPP FAAQPIATAA TGAMADAFQF |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 37 | 44 | RRSRARKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00419 | DAP | Transfer from AT3G62420 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB05G12090.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT841856 | 1e-159 | CT841856.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C105C20, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006654003.1 | 1e-103 | PREDICTED: ocs element-binding factor 1-like | ||||
TrEMBL | J3M3N5 | 1e-101 | J3M3N5_ORYBR; Uncharacterized protein | ||||
STRING | OB05G12090.1 | 1e-102 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1886 | 35 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 2e-21 | basic region/leucine zipper motif 53 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 102704800 |