PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART07G07440.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 204aa MW: 23136.5 Da PI: 10.0897 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.4 | 3.8e-14 | 40 | 86 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEde l + v+ +G W+ Ia+ + t+kqc++rw ++l OBART07G07440.1 40 KGGWTREEDEVLRQMVRHHGDCKWTEIAKSLL-SQTGKQCRERWTNHL 86 688****************************9.************996 PP | |||||||
2 | Myb_DNA-binding | 33.4 | 1e-10 | 93 | 130 | 6 | 45 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +eE+ +l+++++ +G++ W++I r + gR+++ +k++w+ OBART07G07440.1 93 EEEHMKLIEVHRTYGNR-WSAIVRWLL-GRSENTVKNHWN 130 7****************.********9.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.038 | 35 | 90 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.69E-25 | 37 | 129 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.5E-18 | 37 | 92 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-12 | 39 | 88 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.2E-13 | 40 | 86 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.66E-13 | 43 | 86 | No hit | No description |
SMART | SM00717 | 0.0059 | 93 | 135 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.47E-7 | 93 | 130 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.0E-11 | 93 | 130 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.6E-9 | 93 | 130 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.957 | 93 | 130 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MAPSSFRTPR KGLTTASYNS VVAFLQMQAA GSNGNLGLIK GGWTREEDEV LRQMVRHHGD 60 CKWTEIAKSL LSQTGKQCRE RWTNHLYSEI KIEEEHMKLI EVHRTYGNRW SAIVRWLLGR 120 SENTVKNHWN PTKRSLNSKQ RLRKKNSEKA APGQPSHLEE CICSFQNPLL DETAPPPLAP 180 PAPFDIVRYG TCRLIGVIPT PPAI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-27 | 38 | 138 | 5 | 110 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012615 | 0.0 | CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence. | |||
GenBank | DQ989628 | 0.0 | DQ989628.1 Oryza sativa (indica cultivar-group) clone BAC 21O9, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015645903.1 | 5e-88 | transcription factor MYB119 | ||||
Swissprot | Q9LVW4 | 2e-30 | MY118_ARATH; Transcription factor MYB118 | ||||
TrEMBL | A0A0D3GNQ4 | 1e-151 | A0A0D3GNQ4_9ORYZ; Uncharacterized protein | ||||
STRING | OBART07G07440.1 | 1e-152 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1882 | 33 | 101 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27785.1 | 7e-33 | myb domain protein 118 |
Publications ? help Back to Top | |||
---|---|---|---|
|