PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OBART01G37040.1

Organism

Oryza barthii

Taxonomic ID

65489

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

G2-like

Protein Properties

Length: 142aa MW: 14941.1 Da PI: 10.3414

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OBART01G37040.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	94.1	1.1e-29	29	82	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 k+r++WtpeLH+rFveav++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl OBART01G37040.1 29 KARMVWTPELHHRFVEAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 82 68*****************.9*****************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.79E-20	26	86	IPR009057	Homeodomain-like
PROSITE profile	PS51294	11.768	28	85	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.8E-30	28	86	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.4E-25	29	82	IPR006447	Myb domain, plants
Pfam	PF00249	2.4E-10	31	81	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MRTGEGEGGN DDAPAAAAAG GGGGRCGKKA RMVWTPELHH RFVEAVAHLG EKGAVPKAIV 60 RLMNVDGLTR ENVASHLQKY RLYLKRTRVA ATPPPSPPPP PPPPPPLPPA MYVPCFAAKP 120 PLDAANRSDS PPSRTSDATT KQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5lxu_A	2e-27	31	85	3	57	Transcription factor LUX
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269\|PubMed:16006522, ECO:0000269\|PubMed:16164597, ECO:0000269\|PubMed:21236673, ECO:0000269\|PubMed:21753751, ECO:0000269\|PubMed:22311777}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269\|PubMed:16006522, ECO:0000269\|PubMed:16164597, ECO:0000269\|PubMed:17132630, ECO:0000269\|PubMed:21753751}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK066659	0.0	AK066659.1 Oryza sativa Japonica Group cDNA clone:J013068K17, full insert sequence.
GenBank	AP003251	0.0	AP003251.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0446B05.
GenBank	AP014957	0.0	AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBank	CP012609	0.0	CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025878116.1	8e-96	transcription factor PCL1-like
Swissprot	Q9SNB4	3e-30	PCL1_ARATH; Transcription factor LUX
TrEMBL	A0A0D3EW58	4e-97	A0A0D3EW58_9ORYZ; Uncharacterized protein
STRING	OBART01G37040.1	6e-98	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1620	34	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G05090.1	3e-30	G2-like family protein

Publications ? help Back to Top
Higham CF,Husmeier D A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana. BMC Bioinformatics, 2013. 14 Suppl 10: p. S3 [PMID:24267177]