PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 153aa    MW: 16793.2 Da    PI: 9.5765
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616535.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP78.51.8e-241077370
             TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                    +  +r+ ++h kv+g+dRRvRl+ +ca r+F L ++LG+++ + tieWLl qa+ +i ++   ++s+ 
  XP_009616535.1 10 THSTRTRDRHLKVNGKDRRVRLPTSCAQRVFSLNEKLGHKTVGCTIEWLLMQAESSINAILAKKTSAL 77
                    5679*******************************************************999944443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.8E-231483IPR005333Transcription factor, TCP
PROSITE profilePS5136919.2121569IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MDVAPPPPPT HSTRTRDRHL KVNGKDRRVR LPTSCAQRVF SLNEKLGHKT VGCTIEWLLM  60
QAESSINAIL AKKTSALPSP LRLPPVVESS IPTSTHRNRS VLPPFVFCHG LELGAMEFSR  120
EEVERFASTT TSSESVGSSL ASQLMNASNE KIC
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved the regulation of plant development. Together with TCP15, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in leaf and floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Involved in the regulation of seed germination. May regulate the activation of embryonic growth potential during seed germination (PubMed:17953649, PubMed:22155632). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). Involved in positive regulation of plant defense. Represses jasmonate (JA) response to promote disease resistance. Regulates the plant immune system by transcriptionally repressing a subset of JA-responsive genes (PubMed:28132837). {ECO:0000269|PubMed:17953649, ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:22155632, ECO:0000269|PubMed:22267487, ECO:0000269|PubMed:24689742, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:25757472, ECO:0000269|PubMed:28132837}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced during seed imbibition (PubMed:17953649). Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:17953649). {ECO:0000269|PubMed:17953649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616535.11e-109PREDICTED: transcription factor TCP9-like
SwissprotQ93Z003e-18TCP14_ARATH; Transcription factor TCP14
TrEMBLA0A1S3ZSW55e-93A0A1S3ZSW5_TOBAC; transcription factor TCP20-like
STRINGXP_009616535.11e-108(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1567257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.16e-19TCP family protein
Publications ? help Back to Top
  1. Steiner E, et al.
    The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin.
    Plant Physiol., 2016. 171(2): p. 1485-94
    [PMID:27208284]
  2. Yang L, et al.
    Pseudomonas syringae Type III Effector HopBB1 Promotes Host Transcriptional Repressor Degradation to Regulate Phytohormone Responses and Virulence.
    Cell Host Microbe, 2017. 21(2): p. 156-168
    [PMID:28132837]
  3. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  4. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]