PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009603686.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 180aa MW: 21151.5 Da PI: 5.6827 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.2 | 2e-14 | 81 | 132 | 5 | 56 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +++rr+++NRe+ArrsR RK+ ++eL v L +eN++L ++l++ ++ XP_009603686.1 81 RKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLLDKLNHSSERQ 132 689******************************************9988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.2E-14 | 77 | 141 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.254 | 79 | 142 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.3E-12 | 81 | 134 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.8E-11 | 81 | 153 | No hit | No description |
SuperFamily | SSF57959 | 9.14E-13 | 81 | 130 | No hit | No description |
CDD | cd14702 | 4.92E-17 | 82 | 131 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 84 | 99 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MQPTDVTDFY RLLPSNSTQY PSQSCVNYNT STFQLNRLVN PLYHLQITPQ VQEFNPQLTC 60 FNSNSTSDEA DEQQLNLINE RKQRRMISNR ESARRSRMRK QRHLDELWAQ VVWLRNENHQ 120 LLDKLNHSSE RQDQVLEENA QLKKEASELR QMITDMQLSS PCPSLRALED EPCSGLSQNE |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 93 | 100 | RRSRMRKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 0.0 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009603686.1 | 1e-130 | PREDICTED: basic leucine zipper 43-like | ||||
TrEMBL | A0A314L2U2 | 1e-124 | A0A314L2U2_NICAT; Basic leucine zipper 43 | ||||
STRING | XP_009603686.1 | 1e-129 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 1e-51 | basic leucine-zipper 42 |