PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 563aa    MW: 62186.1 Da    PI: 4.6061
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603475.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.77.7e-1371955601374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAea+++++++la+alL+++  la +++ +m ++a+yf+eALa++++r    ly    ps+ ++   ++ l++   f+e++P+lkf+h
  XP_009603475.1 195 LVHTLMACAEAIQQEKMKLAEALLKQIGFLAVSQAGAMGKVATYFAEALARKVYR----LY----PSNPNDPAFTDLLQM--HFYETCPYLKFAH 279
                     689****************************************************....44....444443334555444..5************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea++++++vH+iDf+++qG+QWpaLlqaLa Rp+g+p++R+Tg+g+p++++++ l+++g++La++Ae+++v+fef+ +va++l+dl+
  XP_009603475.1 280 FTANQAILEAFANKNKVHVIDFSMKQGMQWPALLQALALRPGGAPTFRLTGIGPPSQDNTDHLQQIGWKLAQLAESINVEFEFRGFVANSLADLD 374
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak.....lprese 280
                      +++++++gE++aVn++++lh+ll++++ +e+    vL++vk+l+P+++++veqea+hn++ F++rf+e+l+yys+lfdsle       l++ s+
  XP_009603475.1 375 ASMFDIREGETVAVNSMFELHQLLARPGGIEK----VLSFVKDLKPEIFTIVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCggggeLGPVSD 465
                     *******************************9....*********************************************8766777799999* PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++ +++++lgr+i+n+v+ceg +r+erhetl++Wr r+++aGF+pv l+++a kqa++ll+ ++ + gyrvee++g+l+lgW++rpL+++SaW+
  XP_009603475.1 466 QDKLMSEVYLGRQICNLVSCEGVDRVERHETLAQWRTRFNSAGFEPVLLGSNAFKQASMLLALFAgGGGYRVEENNGCLMLGWHTRPLIATSAWK 560
                     *****************************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576126No hitNo description
SMARTSM011291.4E-3341114No hitNo description
PfamPF120411.7E-3441107IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098566.179169539IPR005202Transcription factor GRAS
PfamPF035142.7E-134195560IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MKRDQTMPYE QLEDSFSGGC SSAAGCSEKG NMWEEDGGVD DELLAVLGYK VKASDMAEVA  60
QKLEQLEKVM GSVEQDNLSF LASETVHYNP SDLSSWLESM ISELNPQDPF SNSFTTQTTN  120
QVYEDSSSFD SDLTAIPGKA VFPQIEYSTH EPQQPQSKRF KPTTTTELSS SISTRPAEST  180
RPVVLVDSQD NGVRLVHTLM ACAEAIQQEK MKLAEALLKQ IGFLAVSQAG AMGKVATYFA  240
EALARKVYRL YPSNPNDPAF TDLLQMHFYE TCPYLKFAHF TANQAILEAF ANKNKVHVID  300
FSMKQGMQWP ALLQALALRP GGAPTFRLTG IGPPSQDNTD HLQQIGWKLA QLAESINVEF  360
EFRGFVANSL ADLDASMFDI REGETVAVNS MFELHQLLAR PGGIEKVLSF VKDLKPEIFT  420
IVEQEANHNG PVFMDRFTES LHYYSTLFDS LEGCGGGGEL GPVSDQDKLM SEVYLGRQIC  480
NLVSCEGVDR VERHETLAQW RTRFNSAGFE PVLLGSNAFK QASMLLALFA GGGGYRVEEN  540
NGCLMLGWHT RPLIATSAWK LSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-6220255925377Protein SCARECROW
5b3h_D2e-6220255925377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT3691180.0KT369118.1 Capsicum annuum putative DELLA protein GAI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603475.10.0PREDICTED: DELLA protein GAI1-like
RefseqXP_016441385.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A1S3XN330.0A0A1S3XN33_TOBAC; DELLA protein GAI1-like
STRINGXP_009603475.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein