PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009594857.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 168aa MW: 19257.2 Da PI: 6.1228 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.9 | 1.3e-30 | 105 | 163 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+ ++Cpvkk+ver++ed ++v++tYeg Hnh+ XP_009594857.1 105 LDDGYKWRKYGKKMVKDSPNPRNYYRCSIESCPVKKRVERDKEDCRYVITTYEGVHNHQ 163 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.6E-32 | 91 | 165 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.15E-27 | 98 | 165 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.389 | 100 | 165 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.5E-33 | 105 | 164 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.2E-23 | 106 | 163 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MAANNPSANM SDGSFRSLDS PDSDFSNQLI NFELSDIFEL DNWPVHDDPT FVVSGPSQYS 60 GNEVVVTERS RSYHEGSSNN IGSSRERKEV KDKVAFKTLS QIEILDDGYK WRKYGKKMVK 120 DSPNPRNYYR CSIESCPVKK RVERDKEDCR YVITTYEGVH NHQGPSQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-24 | 95 | 166 | 7 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 4e-24 | 95 | 166 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ871281 | 0.0 | AJ871281.1 Nicotiana tabacum mRNA for putative WRKY transcription factor 11. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009594857.1 | 1e-124 | PREDICTED: probable WRKY transcription factor 50 | ||||
Refseq | XP_016446996.1 | 1e-124 | PREDICTED: probable WRKY transcription factor 50 | ||||
Refseq | XP_016456538.1 | 1e-124 | PREDICTED: probable WRKY transcription factor 50 | ||||
TrEMBL | Q5ND89 | 1e-122 | Q5ND89_TOBAC; Putative WRKY transcription factor 11 | ||||
STRING | XP_009594857.1 | 1e-123 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-38 | WRKY DNA-binding protein 50 |