PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 560aa    MW: 61793.8 Da    PI: 4.806
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590329.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.33.8e-1391795511374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAeav++++++ a+al+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+e++P+lkf+h
  XP_009590329.1 179 LVHTLMACAEAVQQENFNVADALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDSIESSYTDVLQM--HFYETCPYLKFAH 263
                     689****************************************************........44666654445555544..4************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea+ ++++vH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+fef+ +v+++l+dl+
  XP_009590329.1 264 FTANQAILEAFTNCNKVHVIDFSLKQGMQWPALIQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAETIGVEFEFRGFVTNSLADLD 358
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres... 279
                      e L++++    E++aVn+v++lhrll++++++e+    vL+ +k+++Pk+v++veqea+hn++ Fl+rf eal+yys++fdsle+++++ s   
  XP_009590329.1 359 AEILDLRSsteTEVVAVNSVFELHRLLARPGAVEK----VLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSStgs 449
                     ****99988899***********************....***********************************************976665666 PP

            GRAS 280 ......eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                           +++ ++++++lgr+i+nvvacega+r+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL
  XP_009590329.1 450 tqpivnNHDLVMSEVYLGRQICNVVACEGADRVERHETLSQWRVRMNSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENDGCLMLGWHTRPL 544
                     666666999************************************************************************************** PP

            GRAS 368 vsvSaWr 374
                     +++SaWr
  XP_009590329.1 545 IATSAWR 551
                     ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011296.3E-3531104No hitNo description
PfamPF120416.9E-343197IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.837153530IPR005202Transcription factor GRAS
PfamPF035141.3E-136179551IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MKRDRDREKS QDGSSSGKSK IFEEQPDAGM DELLAVLGYK VKYSDMAEVA QKLEQLEMAM  60
CTTLEDGISH LSTDTVHKNP SDLSGWVQSM LSELNNTSVP SNFDLIGSIE EKDLGESSSS  120
IVINEQNRII SDDDLRAIPG GAVFATESNK RQRCCVPLTA DATTRPVVLV DSQETGVRLV  180
HTLMACAEAV QQENFNVADA LVRHIGILAV SQSGAMRKVA TYFAEALARR IYKIYPQDSI  240
ESSYTDVLQM HFYETCPYLK FAHFTANQAI LEAFTNCNKV HVIDFSLKQG MQWPALIQAL  300
ALRPGGPPAF RLTGIGPPQP DNTDALQQVG WKLAQLAETI GVEFEFRGFV TNSLADLDAE  360
ILDLRSSTET EVVAVNSVFE LHRLLARPGA VEKVLNSIKQ MNPKIVTIVE QEANHNASVF  420
LDRFNEALHY YSTMFDSLES SVSTSSTGST QPIVNNHDLV MSEVYLGRQI CNVVACEGAD  480
RVERHETLSQ WRVRMNSAGF DPVHLGSNAF KQASMLLALF AGGDGYRVEE NDGCLMLGWH  540
TRPLIATSAW RFKAPGDAEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6717455014378Protein SCARECROW
5b3h_A3e-6717455013377Protein SCARECROW
5b3h_D3e-6717455013377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ4132520.0JQ413252.1 Nicotiana attenuata ELLA domain GRAS family transcription factor (RGL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590329.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLM9N8J90.0M9N8J9_NICAT; ELLA domain GRAS family transcription factor
STRINGXP_009590329.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]