PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016485773.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 184aa MW: 21198.2 Da PI: 9.7889 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.4 | 8e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRr+g+lKKA+ELS+LCdaeva++ifs++gk y ++s XP_016485773.1 9 KRIENQTSRQVTFSKRRTGLLKKAFELSILCDAEVALLIFSPSGKAYQFAS 59 79**********************************************986 PP | |||||||
2 | K-box | 54.9 | 3.8e-19 | 87 | 160 | 14 | 87 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 +e + e++ + + i++L+ +h+ Ged+++L +keL+qLe+qL ++++iRskK+++l+e+ +lqk+ + + XP_016485773.1 87 TEVRRFEIEDMTRTIDELEARDKHFAGEDISTLGMKELKQLERQLRIGVERIRSKKHKILHEENIHLQKQVRLH 160 555667999**********99***********************************************987654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.057 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.14E-31 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.13E-38 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 5.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.073 | 87 | 184 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.4E-15 | 91 | 158 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MGRGKVELKR IENQTSRQVT FSKRRTGLLK KAFELSILCD AEVALLIFSP SGKAYQFASH 60 DIDRTILRYK NEVGLSKSTN DQGFRATEVR RFEIEDMTRT IDELEARDKH FAGEDISTLG 120 MKELKQLERQ LRIGVERIRS KKHKILHEEN IHLQKQVRLH ELREGEGSST ILDSDASFEL 180 ISKG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 4e-24 | 1 | 81 | 1 | 83 | MEF2C |
5f28_B | 4e-24 | 1 | 81 | 1 | 83 | MEF2C |
5f28_C | 4e-24 | 1 | 81 | 1 | 83 | MEF2C |
5f28_D | 4e-24 | 1 | 81 | 1 | 83 | MEF2C |
6c9l_A | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-24 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}. | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016485773.1 | 1e-130 | PREDICTED: agamous-like MADS-box protein AGL19 isoform X2 | ||||
Swissprot | A0A217EJJ0 | 4e-44 | AG11S_VITVI; Agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 4e-44 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A1S4BAD8 | 1e-129 | A0A1S4BAD8_TOBAC; agamous-like MADS-box protein AGL19 isoform X2 | ||||
STRING | Solyc03g019710.2.1 | 1e-100 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 4e-46 | AGAMOUS-like 19 |