PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016473254.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 179aa MW: 20822.1 Da PI: 7.1643 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 39.2 | 1.5e-12 | 78 | 130 | 2 | 54 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 ++ +++rr+ +NRe+ArrsR RK+ ++eL v L +eN+ L ++l++ ++ XP_016473254.1 78 QQKRKQRRMVSNRESARRSRMRKQRHLDELWSQVLRLRTENQNLMNKLNQVTE 130 67789****************************************99999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.8E-14 | 76 | 141 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.7E-10 | 78 | 131 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.967 | 79 | 142 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.0E-11 | 81 | 131 | No hit | No description |
SuperFamily | SSF57959 | 2.65E-12 | 81 | 131 | No hit | No description |
CDD | cd14702 | 4.95E-18 | 82 | 133 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 84 | 99 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MISSEAAAIH YFAPENNPSS LPIDFSFMHK NLPAFQYNTF LTNNNIQNYN QASFPVQDLS 60 TQPSCISSNS TSDESEEQQK RKQRRMVSNR ESARRSRMRK QRHLDELWSQ VLRLRTENQN 120 LMNKLNQVTE SHDRVIQENM QLKEEASDLR RMIIDSPFHA FSDLDTAHLK AESSNQSTT |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 78 | 84 | QKRKQRR |
2 | 93 | 100 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009612533.1 | 1e-130 | PREDICTED: basic leucine zipper 8-like | ||||
Refseq | XP_016473254.1 | 1e-130 | PREDICTED: basic leucine zipper 8-like | ||||
Swissprot | Q9FMC2 | 6e-33 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A1S4A9J9 | 1e-128 | A0A1S4A9J9_TOBAC; basic leucine zipper 8-like | ||||
STRING | XP_009612533.1 | 1e-129 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 3e-41 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|