PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016468661.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 113aa MW: 13174.1 Da PI: 10.4062 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.8 | 3.9e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCda+v +i+fs++gkl+ey++ XP_016468661.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVGLIVFSTKGKLFEYAT 59 79***********************************************86 PP | |||||||
2 | K-box | 15.1 | 9.6e-07 | 84 | 111 | 9 | 36 |
K-box 9 leeakaeslqqelakLkkeienLqreqR 36 ++++ s++ e+akLk+++e Lqr+qR XP_016468661.1 84 TDHSSPGSWTLEHAKLKARLEVLQRNQR 111 56677889******************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.917 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-33 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.47E-41 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 1.9E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD ADVGLIVFST KGKLFEYATD 60 SCMERILERY ERYSYAERQP VANTDHSSPG SWTLEHAKLK ARLEVLQRNQ RYT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-22 | 1 | 85 | 1 | 83 | MEF2 CHIMERA |
6byy_B | 1e-22 | 1 | 85 | 1 | 83 | MEF2 CHIMERA |
6byy_C | 1e-22 | 1 | 85 | 1 | 83 | MEF2 CHIMERA |
6byy_D | 1e-22 | 1 | 85 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ534202 | 1e-160 | DQ534202.1 Nicotiana tabacum fruitfull-like MADS-box protein (FUL) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009761886.1 | 3e-80 | PREDICTED: agamous-like MADS-box protein AGL8 homolog | ||||
Refseq | XP_016468661.1 | 3e-80 | PREDICTED: agamous-like MADS-box protein AGL8 homolog | ||||
Swissprot | Q42429 | 1e-70 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | A0A1S3ZW89 | 6e-79 | A0A1S3ZW89_TOBAC; agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | A0A1U7VA77 | 6e-79 | A0A1U7VA77_NICSY; agamous-like MADS-box protein AGL8 homolog | ||||
STRING | XP_009761886.1 | 1e-79 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA499 | 23 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 1e-60 | AGAMOUS-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|