PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016462352.1 | ||||||||
Common Name | SPL4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 181aa MW: 20617.9 Da PI: 10.126 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.4 | 1.5e-41 | 50 | 126 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+e+C+adls+ak+yhrrhkvCe h+ka+vv+v+g +qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++ XP_016462352.1 50 CCQAEKCSADLSDAKQYHRRHKVCEYHAKAQVVVVAGFRQRFCQQCSRFHELTEFDESKRSCRRRLAGHNERRRKSS 126 6**************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.6E-33 | 43 | 112 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.317 | 48 | 125 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 7.32E-38 | 50 | 129 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 9.2E-32 | 51 | 124 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
METAGHHNIS TSEDDYKKKR GSCNNNITTN NNHIKKGSLN NGGSSTTQRC CQAEKCSADL 60 SDAKQYHRRH KVCEYHAKAQ VVVVAGFRQR FCQQCSRFHE LTEFDESKRS CRRRLAGHNE 120 RRRKSSSSTA ESHNIAESSS RKGTVQLNNK DINMICGQVN DKGRIQISIQ ENSTFKNFHL 180 R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-36 | 45 | 124 | 5 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP260635 | 0.0 | KP260635.1 Nicotiana tabacum SBP-box 4 (SPL4) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009626190.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 4 | ||||
Refseq | XP_016462352.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 4 | ||||
Swissprot | Q9S7A9 | 3e-43 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A0C5DID3 | 1e-129 | A0A0C5DID3_TOBAC; SBP-box 4 | ||||
STRING | XP_009626190.1 | 1e-130 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 2e-45 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 107785538 |