PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016458099.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NF-YB

Protein Properties

Length: 127aa MW: 14370 Da PI: 4.6164

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016458099.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	150.2	4e-47	5	99	3	97
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 e+ +++Pianv+rimk++lP akisk+aket+qec+sefi+fvt+easdkc++e+r+t+ngdd++wal++lGf++y+e++ yl k re+e+++ XP_016458099.1 5 EHVKLVPIANVGRIMKQILPPTAKISKEAKETIQECASEFIGFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEAMLRYLYKLREFERQR 99 566899**************************************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.8E-45	3	122	IPR009072	Histone-fold
SuperFamily	SSF47113	1.32E-35	10	120	IPR009072	Histone-fold
Pfam	PF00808	3.0E-25	10	73	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	6.2E-16	37	55	No hit	No description
PRINTS	PR00615	6.2E-16	56	74	No hit	No description
PRINTS	PR00615	6.2E-16	75	93	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MEVDEHVKLV PIANVGRIMK QILPPTAKIS KEAKETIQEC ASEFIGFVTG EASDKCHKEN 60 RRTVNGDDIC WALSSLGFDN YAEAMLRYLY KLREFERQRA NQTKGSNDED TDHEAASESE 120 NQDITTT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-36	3	94	1	92	Transcription factor HapC (Eurofung)
4g92_B	1e-36	3	94	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00133	DAP	Transfer from AT1G09030	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975440	1e-89	HG975440.1 Solanum pennellii chromosome ch01, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009760265.1	3e-92	PREDICTED: nuclear transcription factor Y subunit B-4-like
Refseq	XP_016458099.1	3e-92	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	O04027	3e-53	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A1S3Z0U4	7e-91	A0A1S3Z0U4_TOBAC; nuclear transcription factor Y subunit B-4-like
TrEMBL	A0A1U7VEK7	7e-91	A0A1U7VEK7_NICSY; nuclear transcription factor Y subunit B-4-like
STRING	XP_009760265.1	1e-91	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	1e-55	nuclear factor Y, subunit B4

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]