PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016435771.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 207aa MW: 23589.8 Da PI: 6.8006 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.7 | 7.6e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ks rqvtfskRr+g+lKKA+ELS+LCda+vav++fs++g+ly++ss XP_016435771.1 9 KRIEDKSSRQVTFSKRRKGLLKKAKELSILCDADVAVVVFSNRGRLYDFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 50.1 | 1.2e-17 | 79 | 170 | 11 | 99 |
K-box 11 eakaeslqqelak...LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 e+ +e l++e++k e Lq+ R+l +++Ls+ +L +Le+qL+++l + Rs K++l++e+i+ l++kek l+eenk L+++++ XP_016435771.1 79 ESSTEVLDTEHSKyssFMTVGELLQTVERQLEEPAVDDLSVTDLVHLEDQLQTALMQARSSKTHLMIESIKSLREKEKLLSEENKHLENQIA 170 44444455554441115566789*****************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.4E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.665 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-30 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.36E-35 | 2 | 73 | No hit | No description |
PRINTS | PR00404 | 5.1E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.207 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.7E-13 | 93 | 169 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MGRKKVEIKR IEDKSSRQVT FSKRRKGLLK KAKELSILCD ADVAVVVFSN RGRLYDFSST 60 NSLTEIVQQY HSHVEAEKES STEVLDTEHS KYSSFMTVGE LLQTVERQLE EPAVDDLSVT 120 DLVHLEDQLQ TALMQARSSK THLMIESIKS LREKEKLLSE ENKHLENQIA TTKNEREVTN 180 GTMALDFTNL APASMNCRQQ KATLNFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_A | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009795052.1 | 1e-150 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
Refseq | XP_016435771.1 | 1e-150 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
Swissprot | Q9LSR7 | 7e-49 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | A0A1S3X7B1 | 1e-149 | A0A1S3X7B1_TOBAC; agamous-like MADS-box protein AGL27 isoform X1 | ||||
TrEMBL | A0A1U7XSL9 | 1e-149 | A0A1U7XSL9_NICSY; agamous-like MADS-box protein AGL27 isoform X1 | ||||
STRING | XP_009795052.1 | 1e-150 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65050.2 | 4e-42 | AGAMOUS-like 31 |
Publications ? help Back to Top | |||
---|---|---|---|
|