PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009802203.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 223aa MW: 25369 Da PI: 9.5645 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83 | 1.9e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCda++ +i+fs tgkl+eyss XP_009802203.1 9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 48.6 | 3.5e-17 | 83 | 173 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 l++ + +s ++++ L +e + re+R+l Ge+L+ L l+eL++Le+ +e +++++ + K e ++++i+ l+kke +lqeen +L+k+ e XP_009802203.1 83 LQSFNLQSEKKNYGILSREFAEKNRELRQLNGEELQGLGLEELMKLEKIVEGGISRVMKIKGEKFMREISSLKKKEAQLQEENSQLKKQSE 173 677788999999999999999999***************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.777 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.7E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.01E-29 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.18E-37 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.7E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.536 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.6E-14 | 88 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD ADIGLIVFSA TGKLFEYSSS 60 SMMQLIDKHK VHSDRDMDSP DQLQSFNLQS EKKNYGILSR EFAEKNRELR QLNGEELQGL 120 GLEELMKLEK IVEGGISRVM KIKGEKFMRE ISSLKKKEAQ LQEENSQLKK QSEQARLNEV 180 EGHNAIEGGH SADSITTNRS LVNGHLDYID SVTSLKLGLP IPY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-18 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 5e-18 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 5e-18 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 5e-18 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009802200.1 | 1e-161 | PREDICTED: MADS-box protein SVP-like isoform X1 | ||||
Refseq | XP_009802202.1 | 1e-162 | PREDICTED: MADS-box protein SVP-like isoform X3 | ||||
Refseq | XP_009802203.1 | 1e-162 | PREDICTED: MADS-box protein SVP-like isoform X3 | ||||
Refseq | XP_009802205.1 | 1e-162 | PREDICTED: MADS-box protein SVP-like isoform X3 | ||||
Swissprot | Q9FVC1 | 3e-65 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1U7YGC9 | 1e-160 | A0A1U7YGC9_NICSY; MADS-box protein SVP-like isoform X3 | ||||
TrEMBL | A0A1U7YTR6 | 1e-160 | A0A1U7YTR6_NICSY; MADS-box protein SVP-like isoform X1 | ||||
STRING | XP_009802200.1 | 1e-161 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-54 | MIKC_MADS family protein |