PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_026067-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 132aa MW: 14006.8 Da PI: 10.6206 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 54.5 | 1.6e-17 | 73 | 105 | 1 | 33 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 C C t kTp+WR gp g+ktLCnaCG++y++ NNU_026067-RA 73 CLDCATDKTPQWRTGPMGPKTLCNACGVRYKSG 105 889****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.9E-17 | 67 | 118 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.69 | 67 | 103 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 8.55E-15 | 68 | 130 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 4.1E-15 | 68 | 110 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.39E-10 | 72 | 120 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 73 | 98 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 2.0E-15 | 73 | 106 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MSSVRSCMEV KLVTQRSRAA PGNWSSRLLV LSSTTLSSES DVATSSGKKS TKGTPKKRES 60 SDGASGNGEG RKCLDCATDK TPQWRTGPMG PKTLCNACGV RYKSGSLVPA EYRPAASPTF 120 VLTKHSNSHP SR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010267189.1 | 3e-70 | PREDICTED: GATA transcription factor 12-like | ||||
Swissprot | P69781 | 2e-38 | GAT12_ARATH; GATA transcription factor 12 | ||||
TrEMBL | A0A1U8AW42 | 6e-69 | A0A1U8AW42_NELNU; GATA transcription factor | ||||
STRING | XP_010267189.1 | 1e-69 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G25830.1 | 5e-36 | GATA transcription factor 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|