PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_025333-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 187aa MW: 21487.6 Da PI: 9.5497 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.8 | 7.7e-11 | 14 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT........TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg........kgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g ++ + m + R+ k+c++rw +yl NNU_025333-RA 14 KGPWTPEEDIILVSYIQEHGPGVFDYYESLMItgfcesqgLLRCSKSCRLRWTNYL 69 79********************66665566666678899999************97 PP | |||||||
2 | Myb_DNA-binding | 47 | 5.9e-15 | 75 | 120 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l NNU_025333-RA 75 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 120 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-17 | 5 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 8.595 | 9 | 69 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 4.39E-25 | 11 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-6 | 13 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-9 | 14 | 69 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.40E-6 | 16 | 69 | No hit | No description |
PROSITE profile | PS51294 | 23.259 | 70 | 124 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.0E-25 | 73 | 125 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.5E-13 | 74 | 122 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-13 | 75 | 120 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.39E-9 | 77 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGVFDYY ESLMITGFCE SQGLLRCSKS 60 CRLRWTNYLR PGIKRGNFTP HEEGMIIHLQ ALLGNKWAAI ASYLPQRTDN DIKNYWNTHL 120 KKKIKKFQTA LDPQLVSNST NRHLVSKSYS DKRNLDINNH VSLLRLNQSS TYASSTENIS 180 RLLEGWM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-22 | 12 | 124 | 25 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 1e-22 | 14 | 124 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-22 | 14 | 124 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010246153.1 | 1e-121 | PREDICTED: myb-related protein 306 | ||||
Swissprot | B3VTV7 | 3e-93 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A0A1U7YZP8 | 1e-119 | A0A1U7YZP8_NELNU; myb-related protein 306 | ||||
STRING | XP_010246153.1 | 1e-120 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 1e-86 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|