PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G08810.1

Common Name

AtMYB60, MYB60

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 280aa MW: 32017.3 Da PI: 6.1445

Description

myb domain protein 60

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G08810.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.7	1.1e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl AT1G08810.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	46.4	9.3e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l AT1G08810.1 67 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.6E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.093	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	1.35E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.4E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	7.06E-11	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.7E-25	65	117	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.239	66	116	IPR017930	Myb domain
SMART	SM00717	4.2E-13	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	4.3E-13	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	7.90E-9	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009414	Biological Process	response to water deprivation
GO:0009416	Biological Process	response to light stimulus
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010118	Biological Process	stomatal movement
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 280 aa Download sequence Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TPHEEGMIIH LQALLGNKWA SIASYLPQRT DNDIKNYWNT HLKKKLNKSD 120 SDERSRSENI ALQTSSTRNT INHRSTYASS TENISRLLEG WMRASPKSST STTFLEHKMQ 180 NRTNNFIDHH SDQFPYEQLQ GSWEEGHSKG INGDDDQGIK NSENNNGDDV HHEDGDHEDD 240 DDHNATPPLT FIEKWLLEET STTGGQMEEM SHLMELSNML

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-23	14	116	4	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	1e-23	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.10912	0.0	flower\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30680824	0.0
Genevisible	264782_at	0.0
Expression Atlas	AT1G08810	-
AtGenExpress	AT1G08810	-
ATTED-II	AT1G08810	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Specifically expressed in guard cells (PubMed:16005291, PubMed:18036199, PubMed:22088138, PubMed:23828545). Present in seedlings, leaves, stems and flowers (PubMed:16005291, PubMed:22088138). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:18036199, ECO:0000269\|PubMed:22088138, ECO:0000269\|PubMed:23828545}.

Functional Description ? help Back to Top
Source	Description
TAIR	putative transcription factor of the R2R3-MYB gene family. Transcript increases under conditions that promote stomatal opening (white and blue light, abi1-1 mutation) and decreases under conditions that trigger stomatal closure (ABA, desiccation, darkness), with the exception of elevated CO2. Expressed exclusively in guard cells of all tissues. It is required for light-induced opening of stomata. Mutant shows reduced stomatal aperture which helps to limit water loss during drought.
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:21637967}.

Function -- GeneRIF ? help Back to Top
AtMYB60 regulates stomatal movements and plant drought tolerance as a transcriptional modulator of physiological responses in guard cells. [PMID: 16005291] Overexpression of transcription factor AtMYB60 represses anthocyanin biosynthesis in lettuce. [PMID: 18317777] Results demonstrate that phyB and CRY might regulate stomatal opening, at least in part, by regulating MYB60 expression. [PMID: 19965572] MYB60 plays a dual role in abiotic stress responses in Arabidopsis through its involvement in stomatal regulation and root growth. [PMID: 21637967] DOF-binding sites are required for AtMYB60 guard-cells expression. [PMID: 22088138]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00132	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G08810.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:21637967, ECO:0000269\|PubMed:23453954, ECO:0000269\|PubMed:23828545, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G08810

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117469	0.0	AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBank	AY519551	0.0	AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBank	BT005074	0.0	BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_172358.1	0.0	myb domain protein 60
Swissprot	Q8GYP5	0.0	MYB60_ARATH; Transcription factor MYB60
TrEMBL	A0A178WD25	0.0	A0A178WD25_ARATH; MYB60
STRING	AT1G08810.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G08810.1
Entrez Gene	837403
iHOP	AT1G08810
wikigenes	AT1G08810

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Leonhardt N, et al. Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant. Plant Cell, 2004. 16(3): p. 596-615 [PMID:14973164] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Cominelli E, et al. A guard-cell-specific MYB transcription factor regulates stomatal movements and plant drought tolerance. Curr. Biol., 2005. 15(13): p. 1196-200 [PMID:16005291] Brenner WG,Romanov GA,K Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades. Plant J., 2005. 44(2): p. 314-33 [PMID:16212609] Suh MC, et al. Cuticular lipid composition, surface structure, and gene expression in Arabidopsis stem epidermis. Plant Physiol., 2005. 139(4): p. 1649-65 [PMID:16299169] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Galbiati M, et al. Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] Jung C, et al. Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis. Plant Physiol., 2008. 146(2): p. 623-35 [PMID:18162593] Park JS, et al. Arabidopsis R2R3-MYB transcription factor AtMYB60 functions as a transcriptional repressor of anthocyanin biosynthesis in lettuce (Lactuca sativa). Plant Cell Rep., 2008. 27(6): p. 985-94 [PMID:18317777] Wang FF,Lian HL,Kang CY,Yang HQ Phytochrome B is involved in mediating red light-induced stomatal opening in Arabidopsis thaliana. Mol Plant, 2010. 3(1): p. 246-59 [PMID:19965572] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Oh JE, et al. A dual role for MYB60 in stomatal regulation and root growth of Arabidopsis thaliana under drought stress. Plant Mol. Biol., 2011. 77(1-2): p. 91-103 [PMID:21637967] Galbiati M, et al. The grapevine guard cell-related VvMYB60 transcription factor is involved in the regulation of stomatal activity and is differentially expressed in response to ABA and osmotic stress. BMC Plant Biol., 2011. 11: p. 142 [PMID:22018045] Cominelli E, et al. DOF-binding sites additively contribute to guard cell-specificity of AtMYB60 promoter. BMC Plant Biol., 2011. 11: p. 162 [PMID:22088138] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Negi J, et al. A Dof transcription factor, SCAP1, is essential for the development of functional stomata in Arabidopsis. Curr. Biol., 2013. 23(6): p. 479-84 [PMID:23453954] Rusconi F, et al. The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim D,Ntui VO,Xiong L Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]