PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_020134-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 170aa MW: 19655.5 Da PI: 9.5061 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.9 | 4.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl NNU_020134-RA 14 RGLWSPEEDENLIQYINAHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 56 | 9e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr+T+eE++l++ ++ + G++ W+ Ia++++ gRt++++k++w+++ NNU_020134-RA 67 RGRFTPEEEKLIISLHGLVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111 89********************.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-25 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.337 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.27E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.92E-11 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.208 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.9E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.86E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901430 | Biological Process | positive regulation of syringal lignin biosynthetic process | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MGHHSCCNQQ KVKRGLWSPE EDENLIQYIN AHGYGCWSEV PEKAGLQRCG KSCRLRWINY 60 LRPDIKRGRF TPEEEKLIIS LHGLVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPS 120 ATPAMVPSNV KFVQSGYTWN QLDTVNQDLA TIKAPIEERV FSSSCPLFMF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010276890.1 | 1e-125 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9SPG3 | 7e-64 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A1U8BJE9 | 1e-124 | A0A1U8BJE9_NELNU; myb-related protein Myb4-like | ||||
STRING | XP_010276890.1 | 1e-125 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63910.1 | 7e-86 | myb domain protein 103 |
Publications ? help Back to Top | |||
---|---|---|---|
|