PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_019956-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 166aa MW: 19084.1 Da PI: 10.8965 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.1 | 2.4e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++ Ed +l +++++G g W+ +++ g++R++k+c++rw++yl NNU_019956-RA 14 RGSWSAIEDMILTSYINLHGEGKWRELPKRAGLKRCGKSCRLRWLNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.3 | 2.7e-16 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ +++E++l+++++++lG++ W++Ia +++ gRt++++k++w++ NNU_019956-RA 67 RGNISKDEEDLIIKLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110 7899******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.794 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.22E-27 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.8E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.7E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.71E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.783 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-14 | 67 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.16E-10 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MGRRPCCVEE GLNRGSWSAI EDMILTSYIN LHGEGKWREL PKRAGLKRCG KSCRLRWLNY 60 LRPDIKRGNI SKDEEDLIIK LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT KLSKKIQGQT 120 PKIRINGSVE KKAASESFVS SETPPVIKRK PRDALGFFSH GKKETR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-24 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010276720.1 | 1e-118 | PREDICTED: anthocyanin regulatory C1 protein-like | ||||
Swissprot | P10290 | 6e-62 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A1U8B6S4 | 1e-117 | A0A1U8B6S4_NELNU; anthocyanin regulatory C1 protein-like | ||||
STRING | XP_010276720.1 | 1e-118 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 2e-60 | myb domain protein 111 |