PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_019341-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 176aa MW: 20691.3 Da PI: 9.8208 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 156.7 | 1e-48 | 31 | 157 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 ppGfrF P+deelvv yL+kk+ +++l+ + i+ v +y++ P+ L + +++ ++kewyfF++rd+ky++g+r+nr++ +gyWkatg dk+++s NNU_019341-RA 31 PPGFRFTPSDEELVVSYLQKKLLKDRLPK-NKIEVVSLYDYSPQALTEkhETYVRQKEWYFFTHRDRKYPNGSRPNRSAGDGYWKATGADKSIYS- 124 9*************************999.77**************84235556999**************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g +vg kk Lvfykg+ pkgekt+W+mheyr+ NNU_019341-RA 125 DGVHVGYKKALVFYKGKPPKGEKTNWIMHEYRV 157 99*****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.71E-52 | 25 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 48.404 | 30 | 176 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-25 | 31 | 157 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MEDVSSSSPT SVKSPRKTSD SIWDVDFSDI PPGFRFTPSD EELVVSYLQK KLLKDRLPKN 60 KIEVVSLYDY SPQALTEKHE TYVRQKEWYF FTHRDRKYPN GSRPNRSAGD GYWKATGADK 120 SIYSDGVHVG YKKALVFYKG KPPKGEKTNW IMHEYRVAEY IDPRPKEKRH DMRVWF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swm_B | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swm_C | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swm_D | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swp_A | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swp_B | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swp_C | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
3swp_D | 2e-48 | 30 | 159 | 20 | 147 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010275850.1 | 1e-101 | PREDICTED: NAC domain-containing protein 26-like | ||||
Swissprot | K4BNG7 | 2e-49 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | A0A1U8BG55 | 1e-100 | A0A1U8BG55_NELNU; NAC domain-containing protein 26-like | ||||
STRING | XP_010275850.1 | 1e-101 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-49 | NAC-like, activated by AP3/PI |
Publications ? help Back to Top | |||
---|---|---|---|
|