PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_018238-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 197aa MW: 22854.8 Da PI: 8.3337 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.9 | 4.6e-18 | 16 | 62 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +WT+eEd +l++ ++ +G +Wk++a++ g++R++k+c++rw +yl NNU_018238-RA 16 AAWTAEEDRKLAQIIEVHGAQRWKSVAEKAGLNRSGKSCRLRWMNYL 62 68*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.8 | 3.8e-16 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l NNU_018238-RA 68 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.698 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.39E-29 | 13 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.0E-15 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-17 | 16 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-24 | 17 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.71E-11 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 20.665 | 67 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 68 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 70 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.02E-10 | 72 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MALMTDGPAK KELNRAAWTA EEDRKLAQII EVHGAQRWKS VAEKAGLNRS GKSCRLRWMN 60 YLRPNIKRGN ISDQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKVNQK 120 EILRTETTTC GFKRQRTCRD VEKDNLHVNE EGTWEGDVDS PTRLDVDEFL DFSTEGPFSL 180 EWVSKFSDFN ERLCGFS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-28 | 12 | 117 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010273925.1 | 1e-145 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | P10290 | 5e-49 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
Swissprot | Q96276 | 1e-49 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | A0A1U8BBM2 | 1e-144 | A0A1U8BBM2_NELNU; transcription factor MYB114-like | ||||
STRING | XP_010273925.1 | 1e-145 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 4e-52 | myb domain protein 23 |