PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_012803-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 152aa MW: 17645.2 Da PI: 8.2723 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 41.5 | 2.3e-13 | 55 | 84 | 27 | 56 |
HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 27 aeereeLAkklgLterqVkvWFqNrRakek 56 +++++eLA++l+L+ rqV vWFqNrRa+ k NNU_012803-RA 55 KAQKQELAEQLNLQPRQVEVWFQNRRARTK 84 5799************************98 PP | |||||||
2 | HD-ZIP_I/II | 91.2 | 1.2e-29 | 54 | 118 | 25 | 89 |
HD-ZIP_I/II 25 eperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 e+ +K+ela++L+lqprqv+vWFqnrRARtk+kq+E d+e+Lk++y++l++en+rL+ke +eLr+ NNU_012803-RA 54 EKAQKQELAEQLNLQPRQVEVWFQNRRARTKLKQTEIDCEFLKKCYQTLSDENRRLKKEIQELRS 118 678************************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 4.7E-4 | 24 | 90 | IPR001356 | Homeobox domain |
PROSITE profile | PS50071 | 12.908 | 55 | 86 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 9.4E-11 | 55 | 84 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 8.8E-12 | 55 | 84 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.06E-11 | 55 | 95 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.92E-9 | 55 | 87 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 61 | 84 | IPR017970 | Homeobox, conserved site |
Pfam | PF02183 | 1.4E-9 | 86 | 118 | IPR003106 | Leucine zipper, homeobox-associated |
SMART | SM00340 | 2.4E-17 | 86 | 130 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MEEEAAACDI GLSLGLGHRG EFVPRRNRQK PAAPAQFYAC LFPSDQPKEE IIEEKAQKQE 60 LAEQLNLQPR QVEVWFQNRR ARTKLKQTEI DCEFLKKCYQ TLSDENRRLK KEIQELRSTN 120 LNTSPFYIQL PKVATLAICP SCERIAKADY CR |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 78 | 86 | RRARTKLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010265395.2 | 1e-59 | PREDICTED: homeobox-leucine zipper protein HAT22-like | ||||
Swissprot | P46604 | 1e-38 | HAT22_ARATH; Homeobox-leucine zipper protein HAT22 | ||||
TrEMBL | A0A1U8AD31 | 3e-58 | A0A1U8AD31_NELNU; homeobox-leucine zipper protein HAT22-like | ||||
STRING | XP_010265395.1 | 3e-60 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37790.1 | 2e-36 | HD-ZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|