PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf39382g00003.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB_related

Protein Properties

Length: 93aa MW: 11218 Da PI: 10.5322

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf39382g00003.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.5	1.1e-16	8	55	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT++Ed++lv +vk++G ++W+ a+ g++Rt+k+c++rw +yl Niben101Scf39382g00003.1 8 RGPWTEQEDLQLVFYVKLFGDRRWDFLAKVSGLKRTGKSCRLRWVNYL 55 89********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.496	3	59	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.0E-20	3	58	IPR009057	Homeodomain-like
SMART	SM00717	7.3E-13	7	57	IPR001005	SANT/Myb domain
Pfam	PF00249	5.0E-15	8	55	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.75E-21	9	82	IPR009057	Homeodomain-like
CDD	cd00167	1.30E-9	10	55	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.1E-7	59	82	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MVQEEIRRGP WTEQEDLQLV FYVKLFGDRR WDFLAKVSGL KRTGKSCRLR WVNYLNPHLK 60 RGKMTPQEER LVLELHSKWG NRSAISLDSF FFF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-17	1	84	20	102	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019263011.1	2e-53	PREDICTED: transcription factor MYB48-like
Swissprot	Q4JL84	2e-45	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A314L773	4e-52	A0A314L773_NICAT; Transcription factor myb48
STRING	XP_009590049.1	8e-53	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.3	8e-48	myb domain protein 59

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]