PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf12084g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18562.8 Da PI: 8.0509 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.7 | 1.6e-30 | 77 | 135 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk s++pr+YY+C++ gC+vkk+ver+++d ++v++tYeg Hnhe Niben101Scf12084g00003.1 77 LDDGFKWRKYGKKMVKTSPNPRNYYKCSTGGCNVKKRVERDNDDSSYVITTYEGIHNHE 135 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.2E-32 | 63 | 137 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-27 | 70 | 137 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.641 | 72 | 137 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.8E-35 | 77 | 136 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-23 | 78 | 135 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MENFQYSNPN PNYGATDFIG TPEYELSDYF FPVDGLSDDF LLQKDMTSEF IQSVKKYNKV 60 NAKSRVALRF KSELEVLDDG FKWRKYGKKM VKTSPNPRNY YKCSTGGCNV KKRVERDNDD 120 SSYVITTYEG IHNHESPCVL HYTQFPPNFP TYGLHNLRH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-25 | 67 | 137 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 8e-25 | 67 | 137 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009779355.1 | 1e-102 | PREDICTED: probable WRKY transcription factor 50 | ||||
Refseq | XP_016509832.1 | 1e-102 | PREDICTED: probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1S4D8U5 | 1e-100 | A0A1S4D8U5_TOBAC; probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1U7WYP0 | 1e-100 | A0A1U7WYP0_NICSY; probable WRKY transcription factor 50 | ||||
STRING | XP_009779355.1 | 1e-101 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 4e-38 | WRKY DNA-binding protein 50 |