PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07474g04002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 323aa    MW: 37147.4 Da    PI: 9.9353
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07474g04002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171762147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              rg W + Ede+l  +v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  Niben101Scf07474g04002.1 17 RGHWRPAEDERLRLLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 62
                              899*****************************.***********996 PP

2Myb_DNA-binding61.22.2e-1969113147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               r ++T+eE+e+lv a++ +G++ W++I+r ++ gRt++ +k++w+ +
  Niben101Scf07474g04002.1  69 RRPFTEEEEERLVAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHVL 113
                               679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5011263IPR017930Myb domain
SuperFamilySSF466893.37E-2915110IPR009057Homeodomain-like
SMARTSM007179.0E-141665IPR001005SANT/Myb domain
PfamPF002492.0E-161762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-261870IPR009057Homeodomain-like
CDDcd001671.09E-122061No hitNo description
PROSITE profilePS5129428.39964118IPR017930Myb domain
SMARTSM007172.9E-1668116IPR001005SANT/Myb domain
PfamPF002499.0E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2171117IPR009057Homeodomain-like
CDDcd001672.59E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAEGGGSGDD TRSSCPRGHW RPAEDERLRL LVEQYGPQNW NSIAEKLQGR SGKSCRLRWF  60
NQLDPRINRR PFTEEEEERL VAAHRIHGNK WALISRLFPG RTDNAVKNHW HVLMARKQRE  120
QSKNICGKRS YQLQHDNFLS DSKSPSYGFR RRNDSNNNNN LKTQLKGNYC TKISFFEFQN  180
PKKDRVFSIS TYSPELIGRN GSHFFSESSK FSDKKLLCQN NSSFSLCGGY EGAAALGVTN  240
NYKRSTIQNP FSYSVPADDH RINVSDGMTE EVVNIRDSST FSLKKMLRAN IEQQRRQQQQ  300
YGEEAMEKKD IPFIDFLGVG ISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-30171174104C-Myb DNA-Binding Domain
1msf_C1e-30171174104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597907.10.0PREDICTED: myb-related protein B-like
RefseqXP_016438115.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A1S3XE420.0A0A1S3XE42_TOBAC; myb-related protein B-like
STRINGXP_009597907.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.16e-66myb domain protein 52