PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf03872g02002.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

TCP

Protein Properties

Length: 155aa MW: 17266.6 Da PI: 9.5751

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf03872g02002.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	72.9	1e-22	15	79	6	70
TCP 6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 +r+ ++h k + +dRR+Rl+ +ca r+F L+++LG+++ + tieWLl qa ai ++ ++s+ Niben101Scf03872g02002.1 15 TRTRDRHLKINRKDRRIRLPTSCAQRVFSLTEKLGHKTVGCTIEWLLVQADSAINAILAKKTSAL 79 79******************************************************999944433 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	2.3E-23	16	83	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	17.989	17	71	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 155 aa Download sequence Send to blast
MDAPSPPPPG NRPSTRTRDR HLKINRKDRR IRLPTSCAQR VFSLTEKLGH KTVGCTIEWL 60 LVQADSAINA ILAKKTSALP SPQRLPPVVE NSIPTSTHRN RNVLPPFVFC HGLELGDMEF 120 SRDEIERFAS TNTSSESVGS SLPEQHMNVS NEKNC

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). {ECO:0000269\|PubMed:21668538, ECO:0000269\|PubMed:22267487, ECO:0000269\|PubMed:24689742, ECO:0000269\|PubMed:25655823, ECO:0000269\|PubMed:25757472, ECO:0000269\|PubMed:26303297, ECO:0000269\|PubMed:26574599}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:21183706). Induced during seed imbibition (PubMed:25655823). Induced by cytokinin (PubMed:26303297). {ECO:0000269\|PubMed:21183706, ECO:0000269\|PubMed:25655823, ECO:0000269\|PubMed:26303297}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019260924.1	2e-95	PREDICTED: transcription factor TCP11-like
Swissprot	Q9C9L2	1e-16	TCP15_ARATH; Transcription factor TCP15
TrEMBL	A0A1J6IWH3	3e-94	A0A1J6IWH3_NICAT; Transcription factor tcp11
STRING	XP_009616535.1	2e-88	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA15672	5	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G72010.1	3e-17	TCP family protein

Publications ? help Back to Top
Steiner E, et al. The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin. Plant Physiol., 2016. 171(2): p. 1485-94 [PMID:27208284] Dong H, et al. Ubiquitylation activates a peptidase that promotes cleavage and destabilization of its activating E3 ligases and diverse growth regulatory proteins to limit cell proliferation in Arabidopsis. Genes Dev., 2017. 31(2): p. 197-208 [PMID:28167503] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Mazur MJ, et al. Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci. Front Plant Sci, 2017. 8: p. 2043 [PMID:29250092]