PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03779g06005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 248aa    MW: 28759.2 Da    PI: 7.6238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03779g06005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-072164445
                              S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                              WT+eE +l+  a++ +  +   +W ++a +++ g++  ++   +q
  Niben101Scf03779g06005.1 21 WTKEENKLFESAIAIYDENtpnRWFKVADMIP-GKSVLDVMMQYQ 64
                              ******************9*************.***999887777 PP

2Myb_DNA-binding44.43.7e-14110154347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ +++ +  ++G+g+W+ I+++m   Rt+ q+ s+ qky
  Niben101Scf03779g06005.1 110 PWTEEEHRRFLMGLDKYGKGDWRNISKKMVISRTPTQVASHAQKY 154
                               8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.6271671IPR017884SANT domain
SMARTSM007171.5E-81769IPR001005SANT/Myb domain
SuperFamilySSF466892.07E-111973IPR009057Homeodomain-like
PfamPF002495.9E-62165IPR001005SANT/Myb domain
CDDcd001672.33E-72166No hitNo description
Gene3DG3DSA:1.10.10.601.1E-12101159IPR009057Homeodomain-like
PROSITE profilePS5129421.106103159IPR017930Myb domain
SuperFamilySSF466892.0E-16104158IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-18106158IPR006447Myb domain, plants
SMARTSM007174.7E-12107157IPR001005SANT/Myb domain
CDDcd001671.48E-9110154No hitNo description
PfamPF002491.7E-12110154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
METIFPTSSS WMIQQNKNSI WTKEENKLFE SAIAIYDENT PNRWFKVADM IPGKSVLDVM  60
MQYQELAADV CDIEAGLVPN PGYFVSSDCG LQTFRKRGRS SDQERKKGVP WTEEEHRRFL  120
MGLDKYGKGD WRNISKKMVI SRTPTQVASH AQKYYQRQLS GCKDKRRPSI HDITTFHFVA  180
DDASQNYVNS LSKEKFHKFI TTTDVVKYWN NSSDEHLMDF RSSYGSSTVA YPYEISSQSW  240
DVHGAIWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194106RKRGRSSDQERKK
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766549.11e-175PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016501061.11e-175PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-74DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S4CJ871e-174A0A1S4CJ87_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7VVW51e-174A0A1U7VVW5_NICSY; transcription factor DIVARICATA-like
STRINGXP_009766549.11e-174(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-81MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]