PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G11280.2 | ||||||||
Common Name | F11B9.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 263aa MW: 29608.2 Da PI: 6.7299 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.2 | 1.6e-07 | 31 | 77 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 g+WT+eE + + +a + + + +W ++a++++ g+t ++ + k AT3G11280.2 31 GSWTKEENKMFERALAIYAEDspdRWFKVASMIP-GKTVFDVMKQYSK 77 89*****************99*************.***9999888876 PP | |||||||
2 | Myb_DNA-binding | 39.9 | 9.8e-13 | 128 | 172 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + ++G+g+W+ I+r + +t+ q+ s+ qky AT3G11280.2 128 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 172 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 8.349 | 28 | 81 | IPR017884 | SANT domain |
SMART | SM00717 | 1.7E-8 | 29 | 81 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-4 | 30 | 77 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.1E-6 | 31 | 77 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.33E-12 | 31 | 86 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.12E-7 | 33 | 78 | No hit | No description |
PROSITE profile | PS51294 | 18.577 | 121 | 177 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.3E-15 | 123 | 176 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.5E-17 | 124 | 176 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.7E-10 | 125 | 175 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.3E-11 | 125 | 177 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.90E-9 | 128 | 172 | No hit | No description |
Pfam | PF00249 | 4.2E-10 | 128 | 172 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 263 aa Download sequence Send to blast |
METLHPFSHL PISDHRFVVQ EMVSLHSSSS GSWTKEENKM FERALAIYAE DSPDRWFKVA 60 SMIPGKTVFD VMKQYSKLEE DVFDIEAGRV PIPGYPAASS PLGFDTDMCR KRPSGARGSD 120 QDRKKGVPWT EEEHRRFLLG LLKYGKGDWR NISRNFVVSK TPTQVASHAQ KYYQRQLSGA 180 KDKRRPSIHD ITTGNLLNAN LNRSFSDHRD ILPDLGFIDK DDTEEGVIFM GQNLSSENLF 240 SPSPTSFEAA INFAGENVFS AGA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-16 | 27 | 110 | 2 | 88 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.23548 | 0.0 | flower| leaf| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 256255_at | 0.0 | ||||
Expression Atlas | AT3G11280 | - | ||||
AtGenExpress | AT3G11280 | - | ||||
ATTED-II | AT3G11280 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Putative transcription factors interacting with the gene product of VHA-B1 (vacuolar ATPase subunit B1; as shown through yeast two-hybrid assay). | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00347 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G11280.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | salicylic acid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G11280 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY056180 | 0.0 | AY056180.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds. | |||
GenBank | AY091265 | 0.0 | AY091265.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds. | |||
GenBank | AY550308 | 0.0 | AY550308.1 Arabidopsis thaliana MYB transcription factor (At3g11280) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_187737.1 | 0.0 | Duplicated homeodomain-like superfamily protein | ||||
Refseq | NP_850558.1 | 0.0 | Duplicated homeodomain-like superfamily protein | ||||
Swissprot | Q8S9H7 | 2e-71 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A384KX37 | 0.0 | A0A384KX37_ARATH; Uncharacterized protein | ||||
TrEMBL | Q9C773 | 0.0 | Q9C773_ARATH; Duplicated homeodomain-like superfamily protein | ||||
STRING | AT3G11280.2 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G11280.2 |
Entrez Gene | 820299 |
iHOP | AT3G11280 |
wikigenes | AT3G11280 |