PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf01727g09001.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB

Protein Properties

Length: 322aa MW: 35897.1 Da PI: 5.7535

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf01727g09001.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.6	3e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd lv +v+++G+g+W++++ + g++R+ k+c++rw +yl Niben101Scf01727g09001.1 14 KGPWTPEEDIMLVSYVQEHGPGNWRAVPTKTGLRRCSKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	48.6	1.8e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E++ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l Niben101Scf01727g09001.1 67 RGSFTDQEEKMIIQLQALLGNK-WAAIASYLP-ERTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.873	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	5.5E-31	11	108	IPR009057	Homeodomain-like
SMART	SM00717	5.6E-15	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	6.1E-17	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	3.09E-11	16	61	No hit	No description
PROSITE profile	PS51294	20.018	66	116	IPR017930	Myb domain
SMART	SM00717	8.3E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-14	67	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.5E-25	69	117	IPR009057	Homeodomain-like
CDD	cd00167	5.98E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 322 aa Download sequence Send to blast
MGRPPCCDKV GVKKGPWTPE EDIMLVSYVQ EHGPGNWRAV PTKTGLRRCS KSCRLRWTNY 60 LRPGIKRGSF TDQEEKMIIQ LQALLGNKWA AIASYLPERT DNDIKNYWNT HLKKKMKNLE 120 EKSSGDDDLL SVQNGHNLSS SNSTSRGQWE RTLQADINMA KKALHNALSL ENSTPYIKQE 180 TPAPVSSYAS STENIARLLQ GWMRSSSLNN SENSKTSSNN IATADSSSCD GTPSAESKGG 240 MVLMEALETL FGLESFEPSS SDQLSQTASP EASKFQVEIK KEENNSNVPL SVMLENWLFD 300 ENTIQVKHDL TSFSFDETAD LF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	1e-26	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	1e-26	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	8e-27	14	116	27	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269\|PubMed:19625633, ECO:0000269\|PubMed:20149112, ECO:0000269\|PubMed:21398568, ECO:0000269\|PubMed:23404903, ECO:0000269\|PubMed:25616734, ECO:0000269\|PubMed:25869652, ECO:0000269\|PubMed:25912720, ECO:0000269\|PubMed:26725725, ECO:0000269\|PubMed:27577115}.
UniProt	Transcription factor. {ECO:0000305}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269\|PubMed:10226370, ECO:0000269\|PubMed:19625633, ECO:0000269\|PubMed:25912720}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009765566.1	0.0	PREDICTED: myb-related protein 306-like
Refseq	XP_016463903.1	0.0	PREDICTED: myb-related protein 306-like
Swissprot	P81392	1e-101	MYB06_ANTMA; Myb-related protein 306
Swissprot	Q24JK1	1e-101	MYB96_ARATH; Transcription factor MYB96
TrEMBL	A0A1S3ZHJ1	0.0	A0A1S3ZHJ1_TOBAC; myb-related protein 306-like
TrEMBL	A0A1U7VKS9	0.0	A0A1U7VKS9_NICSY; myb-related protein 306-like
STRING	XP_009765566.1	0.0	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62470.2	1e-101	myb domain protein 96

Publications ? help Back to Top
Geri C,Cecchini E,Giannakou ME,Covey SN,Milner JJ Altered patterns of gene expression in Arabidopsis elicited by cauliflower mosaic virus (CaMV) infection and by a CaMV gene VI transgene. Mol. Plant Microbe Interact., 1999. 12(5): p. 377-84 [PMID:10226370] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lee HG,Seo PJ The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis. Plant J., 2015. 82(6): p. 962-77 [PMID:25912720] Lee HG,Mas P,Seo PJ MYB96 shapes the circadian gating of ABA signaling in Arabidopsis. Sci Rep, 2016. 6: p. 17754 [PMID:26725725] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495] Lee HG,Choi YR,Seo PJ Increased STM expression is associated with drought tolerance in Arabidopsis. J. Plant Physiol., 2016. 201: p. 79-84 [PMID:27448723] Lee SB,Kim HU,Suh MC MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis. Plant Cell Physiol., 2016. 57(11): p. 2300-2311 [PMID:27577115] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Li P, et al. The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses. Physiol Plant, 2017. 159(4): p. 416-432 [PMID:27747895] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Lee HG,Kim H,Suh MC,Kim HU,Seo PJ The MYB96 Transcription Factor Regulates Triacylglycerol Accumulation by Activating DGAT1 and PDAT1 Expression in Arabidopsis Seeds. Plant Cell Physiol., 2018. 59(7): p. 1432-1442 [PMID:29660088] Lee HG,Seo PJ MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis. Nat Commun, 2019. 10(1): p. 1713 [PMID:30979883]