PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf01479g01006.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 75aa MW: 8942.26 Da PI: 4.8435 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 61.7 | 2.4e-19 | 22 | 68 | 2 | 49 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 pGfrFhPtdeelv +yL++kve+k++++ e ik++diyk++PwdLp+ Niben101Scf01479g01006.1 22 LPGFRFHPTDEELVGFYLRRKVENKRTNI-ELIKQIDIYKYDPWDLPM 68 69************************999.89**************94 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.36E-18 | 19 | 70 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 19.578 | 21 | 75 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.0E-9 | 23 | 64 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MELKDVAVAK TIKDGEEEEV TLPGFRFHPT DEELVGFYLR RKVENKRTNI ELIKQIDIYK 60 YDPWDLPMLY THTTI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-15 | 13 | 67 | 7 | 61 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009621672.1 | 1e-38 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Refseq | XP_009772560.1 | 5e-39 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9SK55 | 5e-26 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A1S3XIG2 | 1e-36 | A0A1S3XIG2_TOBAC; transcription factor JUNGBRUNNEN 1-like | ||||
TrEMBL | A0A1U7WEA5 | 1e-37 | A0A1U7WEA5_NICSY; transcription factor JUNGBRUNNEN 1-like | ||||
STRING | XP_009772560.1 | 2e-38 | (Nicotiana sylvestris) | ||||
STRING | XP_009621672.1 | 4e-38 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA16497 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 2e-28 | NAC domain containing protein 42 |