PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G43000.1 | ||||||||
Common Name | ANAC042, F23E6.1, JUB1, NAC042 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 275aa MW: 31456.3 Da PI: 8.2991 | ||||||||
Description | NAC domain containing protein 42 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.2 | 4e-50 | 20 | 143 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v+s + v AT2G43000.1 20 PGFRFHPTDEELLGYYLRRKVENKTIKL-ELIKQIDIYKYDPWDLPRVSSVGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATGIDKPVYS-NLDCV 115 9***************************.99***************7777799***************************************.9999* PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 glkk+Lv+y g+a kg+ktdW+mhe+rl AT2G43000.1 116 GLKKSLVYYLGSAGKGTKTDWMMHEFRL 143 **************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 53.085 | 18 | 167 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.7E-55 | 19 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-25 | 20 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005992 | Biological Process | trehalose biosynthetic process | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006561 | Biological Process | proline biosynthetic process | ||||
GO:0009718 | Biological Process | anthocyanin-containing compound biosynthetic process | ||||
GO:0010120 | Biological Process | camalexin biosynthetic process | ||||
GO:0042538 | Biological Process | hyperosmotic salinity response | ||||
GO:1900056 | Biological Process | negative regulation of leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 275 aa Download sequence Send to blast |
MSGEGNLGKD HEEENEAPLP GFRFHPTDEE LLGYYLRRKV ENKTIKLELI KQIDIYKYDP 60 WDLPRVSSVG EKEWYFFCMR GRKYRNSVRP NRVTGSGFWK ATGIDKPVYS NLDCVGLKKS 120 LVYYLGSAGK GTKTDWMMHE FRLPSTTKTD SPAQQAEVWT LCRIFKRVTS QRNPTILPPN 180 RKPVITLTDT CSKTSSLDSD HTSHRTVDSM SHEPPLPQPQ NPYWNQHIVG FNQPTYTGND 240 NNLLMSFWNG NGGDFIGDSA SWDELRSVID GNTKP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-53 | 20 | 173 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-53 | 20 | 173 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-53 | 20 | 173 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-53 | 20 | 173 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-53 | 20 | 173 | 22 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-53 | 20 | 173 | 19 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-53 | 20 | 173 | 19 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 265260_at | 0.0 | ||||
Expression Atlas | AT2G43000 | - | ||||
AtGenExpress | AT2G43000 | - | ||||
ATTED-II | AT2G43000 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269|PubMed:22345491}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00310 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G43000.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G14920 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: Precocious senescence and lowered abiotic stress tolerance. {ECO:0000269|PubMed:22345491}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G43000 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493587 | 0.0 | AB493587.1 Arabidopsis thaliana At2g43000 mRNA for hypothetical protein, partial cds, clone: RAAt2g43000. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_181828.1 | 0.0 | NAC domain containing protein 42 | ||||
Swissprot | Q9SK55 | 0.0 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A178VL40 | 0.0 | A0A178VL40_ARATH; NAC042 | ||||
STRING | AT2G43000.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G43000.1 |
Entrez Gene | 818902 |
iHOP | AT2G43000 |
wikigenes | AT2G43000 |