PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf00332g07018.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

TCP

Protein Properties

Length: 99aa MW: 11308.7 Da PI: 10.4872

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf00332g07018.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	55.4	2.5e-17	60	95	2	37
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqd 37 a+k+++++++hTkv+gR+RR+R++a+caar+F+L++ Niben101Scf00332g07018.1 60 APKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTR 95 789********************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	1.3E-12	65	95	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	14.667	66	99	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MDPKGSKQPQ EEISNFLSHP NPKNINTNIS SNMGENNLVE INDFQIENSD KDETKKQQLA 60 PKRSSNKDRH TKVEGRGRRI RMPALCAARI FQLTRFSNA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269\|PubMed:12631321, ECO:0000269\|PubMed:16123132}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009757310.1	2e-57	PREDICTED: transcription factor TCP20 isoform X2
Swissprot	Q9LSD5	8e-23	TCP20_ARATH; Transcription factor TCP20
TrEMBL	A0A1U7V6F6	5e-56	A0A1U7V6F6_NICSY; transcription factor TCP20 isoform X2
STRING	XP_009757309.1	1e-56	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA248	24	201

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27010.1	3e-25	TCP family protein

Publications ? help Back to Top
Zhu P, et al. Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972 [PMID:27708161] Wu JF, et al. LWD-TCP complex activates the morning gene CCA1 in Arabidopsis. Nat Commun, 2016. 7: p. 13181 [PMID:27734958] Guan P, et al. Interacting TCP and NLP transcription factors control plant responses to nitrate availability. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424 [PMID:28202720] Guan P Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis. Front Plant Sci, 2017. 8: p. 1697 [PMID:29033968] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375] Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis. Microbes Environ., 2017. 32(4): p. 314-323 [PMID:29187692]